(data stored in ACNUC7421 zone)

EMBL: CP002047.SIG5

CP002047.SIG5        Location/Qualifiers
FT   CDS             449956..450534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sig5"
FT                   /locus_tag="SBI_00381"
FT                   /product="ECF subfamily RNA polymerase sigma factor"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00381"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03502"
FT                   /db_xref="GOA:D7BYH4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH4"
FT                   /protein_id="ADI03502.1"
FT                   /translation="MGVADSAWPSEQLVVAAQRGDVDSIAALVSGSHPNVQRFAHSLCA
FT                   TPEDAEDAAQEALIILYRKIGMLRASGALASWMFRIVRNECLRRARTMMRGHPPLPDTA
FT                   VDTAVDSAEDEALRRLDASRVAAAVAALPPDQRRVLIMRDVQGHSGRMVADALGLSTAA
FT                   MKSRLHRARAAVRHTLRTAAPDSPPGGNP"
     MGVADSAWPS EQLVVAAQRG DVDSIAALVS GSHPNVQRFA HSLCATPEDA EDAAQEALII        60
     LYRKIGMLRA SGALASWMFR IVRNECLRRA RTMMRGHPPL PDTAVDTAVD SAEDEALRRL       120
     DASRVAAAVA ALPPDQRRVL IMRDVQGHSG RMVADALGLS TAAMKSRLHR ARAAVRHTLR       180
     TAAPDSPPGG NP                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page