(data stored in ACNUC7421 zone)

EMBL: CP002047.TERD1

CP002047.TERD1       Location/Qualifiers
FT   CDS             265450..266337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="terD1"
FT                   /locus_tag="SBI_00244"
FT                   /product="putative tellurium resistance protein"
FT                   /note="COG3793 Tellurite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00244"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03365"
FT                   /db_xref="GOA:D7BWK9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BWK9"
FT                   /protein_id="ADI03365.1"
FT                   /translation="MALWDRIKDTAQTMQAQLTAKKNELQSGAFRDASMAMCALVAAAD
FT                   GTIDTSERQRVAQLIATNDVLQHFPPDDLHHRFEEHLDKLTGDFPLGKVSAMREIGKAR
FT                   RKPAEARAVIQIGIVIGCADGYFDDSERAVVREVCTALDIPPAEFDLHRALRAPRRYRA
FT                   LDELPQVAGDRLSPPADSGTAQAVRPEAAIPDDDLQVFLKALASTTRQKLFSHFADGEE
FT                   LTVGEVAERAGLGPSTTSEHLAVLRRGGLLQSTRTGKLVRYRADQEGIVELLDQLHSYL
FT                   LSPSAPQDTRTPQS"
     MALWDRIKDT AQTMQAQLTA KKNELQSGAF RDASMAMCAL VAAADGTIDT SERQRVAQLI        60
     ATNDVLQHFP PDDLHHRFEE HLDKLTGDFP LGKVSAMREI GKARRKPAEA RAVIQIGIVI       120
     GCADGYFDDS ERAVVREVCT ALDIPPAEFD LHRALRAPRR YRALDELPQV AGDRLSPPAD       180
     SGTAQAVRPE AAIPDDDLQV FLKALASTTR QKLFSHFADG EELTVGEVAE RAGLGPSTTS       240
     EHLAVLRRGG LLQSTRTGKL VRYRADQEGI VELLDQLHSY LLSPSAPQDT RTPQS            295
//

If you have problems or comments...

PBIL Back to PBIL home page