(data stored in ACNUC30630 zone)

EMBL: CP002049.PE109

CP002049.PE109       Location/Qualifiers
FT   CDS             128327..129268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0110"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG4558 ABC-type hemin transport system
FT                   periplasmic component; InterPro IPR002491; KEGG:
FT                   ttj:TTHB220 hemin ABC transporter, periplasmic
FT                   hemin-binding protein; PFAM: periplasmic binding protein;
FT                   SPTR: C1XQC8 ABC-type hemin transport system, periplasmic
FT                   component; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13252"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXC8"
FT                   /protein_id="ADI13252.1"
FT                   /translation="MNVLSVCPPLRALLVALAVLAPAPAVAAGAMGAAVPPEARIVSLH
FT                   FYATEALLELGLSEQVVGIDIMSRSYYDAALDRSFAELPVIGHWADLSAESVLALQPTL
FT                   VVGTERSGPETAVRQLQGATEVLLLDPRDDLAGALARVGQLAAHLGLEGRAAALEAEMA
FT                   AVRAELAARTAAVEPVGALALASHGGVERVCGRGPHETLLELAGLTNLAPQVSACEELS
FT                   REALVGIDAEVLVFSNPETFDFFGGHEGLSAHPVFGRTEAVRQERYIVLGSAEQVLGVG
FT                   LRTPSFALALHEAVYGHEGPVVIERDLAVAPL"
     MNVLSVCPPL RALLVALAVL APAPAVAAGA MGAAVPPEAR IVSLHFYATE ALLELGLSEQ        60
     VVGIDIMSRS YYDAALDRSF AELPVIGHWA DLSAESVLAL QPTLVVGTER SGPETAVRQL       120
     QGATEVLLLD PRDDLAGALA RVGQLAAHLG LEGRAAALEA EMAAVRAELA ARTAAVEPVG       180
     ALALASHGGV ERVCGRGPHE TLLELAGLTN LAPQVSACEE LSREALVGID AEVLVFSNPE       240
     TFDFFGGHEG LSAHPVFGRT EAVRQERYIV LGSAEQVLGV GLRTPSFALA LHEAVYGHEG       300
     PVVIERDLAV APL                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page