(data stored in ACNUC30630 zone)

EMBL: CP002049.PE135

CP002049.PE135       Location/Qualifiers
FT   CDS             157409..157915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0136"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rrs:RoseRS_3476 anti-sigma-factor antagonist;
FT                   SPTR: A5UYY1 Anti-sigma-factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13278"
FT                   /db_xref="GOA:D7CXF4"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXF4"
FT                   /protein_id="ADI13278.1"
FT                   /translation="MNRQLRRANERSDKRREREQERRKEARRAARVVPAPRKNAATPEA
FT                   APKTRPAPGTLRQGLSLAYLVLVVGILLAQAFVPQRTDPFSLFVHALFYVIFGYFLALQ
FT                   LFRRGVARAGPVTVVAGLLLAALVEAAKLLTGAGAPEAVLVALALPGLLLGAWLGGFVH
FT                   RQEGR"
     MNRQLRRANE RSDKRREREQ ERRKEARRAA RVVPAPRKNA ATPEAAPKTR PAPGTLRQGL        60
     SLAYLVLVVG ILLAQAFVPQ RTDPFSLFVH ALFYVIFGYF LALQLFRRGV ARAGPVTVVA       120
     GLLLAALVEA AKLLTGAGAP EAVLVALALP GLLLGAWLGG FVHRQEGR                    168
//

If you have problems or comments...

PBIL Back to PBIL home page