(data stored in ACNUC30630 zone)

EMBL: CP002049.PE143

CP002049.PE143       Location/Qualifiers
FT   CDS             complement(166609..166857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ddr:Deide_22810 hypothetical protein; SPTR:
FT                   C1D044 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13286"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXG2"
FT                   /protein_id="ADI13286.1"
FT                   /translation="MPWPSLTEVRHAHLRARFAERSAEWHLVIKEYLFCLEAAECAQDV
FT                   RAIRFFALRLAHAYRTIGMPHKAERYRELGAVPTELR"
     MPWPSLTEVR HAHLRARFAE RSAEWHLVIK EYLFCLEAAE CAQDVRAIRF FALRLAHAYR        60
     TIGMPHKAER YRELGAVPTE LR                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page