(data stored in ACNUC30630 zone)

EMBL: CP002049.PE151

CP002049.PE151       Location/Qualifiers
FT   CDS             complement(175971..176240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0152"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH0735 hypothetical protein; SPTR: Q9KEW4
FT                   BH0735 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13294"
FT                   /db_xref="GOA:D7CXT4"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXT4"
FT                   /protein_id="ADI13294.1"
FT                   /translation="MDHRDPYVSDAPRGARGGFDVISVGNWLLTLVLLAIPLVNLVALL
FT                   YWAFAGAVHPSKRTFAQAGLILTVISASFYLLLLFTGTAVPLTP"
     MDHRDPYVSD APRGARGGFD VISVGNWLLT LVLLAIPLVN LVALLYWAFA GAVHPSKRTF        60
     AQAGLILTVI SASFYLLLLF TGTAVPLTP                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page