(data stored in ACNUC30630 zone)

EMBL: CP002049.PE157

CP002049.PE157       Location/Qualifiers
FT   CDS             181821..182681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0158"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: rle:RL4415 putative transmembrane component of ABC
FT                   transporter; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: Q2CJI8 Oligopeptide
FT                   ABC transporter, permease protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13300"
FT                   /db_xref="GOA:D7CXU0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXU0"
FT                   /protein_id="ADI13300.1"
FT                   /translation="MFSVFKDLLRYNTEFAIGVVLVGVVVVYAGLSFFSSVDPTLMYTV
FT                   MPDMAPSAEHWFGTNSRGQDMFWQLSFAFRNTLVFGLLVVVLSRIISITVGLVSGYLGG
FT                   ATDRALMFVNDIFVALPIFPILVLFYFTMRSDLNTVNLAFLMACLGWPFDARLIRSVAL
FT                   GLRHREFTRHAVFSGMSARKIMFEEHLPYVMPIIFSTAMANLIWAIGLEVTLAVLGFTN
FT                   INIPTVGTTIYWANNHSALVVGVWWWVVIPVVLIVMLFIGLFLLAVSINEYIDPRSRLR
FT                   RMERA"
     MFSVFKDLLR YNTEFAIGVV LVGVVVVYAG LSFFSSVDPT LMYTVMPDMA PSAEHWFGTN        60
     SRGQDMFWQL SFAFRNTLVF GLLVVVLSRI ISITVGLVSG YLGGATDRAL MFVNDIFVAL       120
     PIFPILVLFY FTMRSDLNTV NLAFLMACLG WPFDARLIRS VALGLRHREF TRHAVFSGMS       180
     ARKIMFEEHL PYVMPIIFST AMANLIWAIG LEVTLAVLGF TNINIPTVGT TIYWANNHSA       240
     LVVGVWWWVV IPVVLIVMLF IGLFLLAVSI NEYIDPRSRL RRMERA                      286
//

If you have problems or comments...

PBIL Back to PBIL home page