(data stored in ACNUC30630 zone)

EMBL: CP002049.PE165

CP002049.PE165       Location/Qualifiers
FT   CDS             complement(191143..191640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xce:Xcel_1008 hypothetical protein; SPTR:
FT                   D1BK51 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13308"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXU8"
FT                   /protein_id="ADI13308.1"
FT                   /translation="MLTPEPCGPLEVPIAQLVLPFPEALALATADKPLPPPVERVSCSG
FT                   STVHVTLNPEALLPRPLRALAPRVRLELHYLGFAAGVVSFSLVSSVLALPIHRLLNLLT
FT                   AAIPLPPGVSVHKGAAAPELRVDVQALLNRQLSGVTLTELYLHDGDVVMVARIDNVRRP
FT                   PA"
     MLTPEPCGPL EVPIAQLVLP FPEALALATA DKPLPPPVER VSCSGSTVHV TLNPEALLPR        60
     PLRALAPRVR LELHYLGFAA GVVSFSLVSS VLALPIHRLL NLLTAAIPLP PGVSVHKGAA       120
     APELRVDVQA LLNRQLSGVT LTELYLHDGD VVMVARIDNV RRPPA                       165
//

If you have problems or comments...

PBIL Back to PBIL home page