(data stored in ACNUC30630 zone)

EMBL: CP002049.PE179

CP002049.PE179       Location/Qualifiers
FT   CDS             207887..209410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0181"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="COGs: COG1472 Beta-glucosidase-related glycosidase;
FT                   InterPro IPR001764:IPR017853:IPR019800; KEGG: cvi:CV_0259
FT                   glycosy hydrolase family protein; PFAM: glycoside hydrolase
FT                   family 3 domain protein; SPTR: C1XRD5 Beta-glucosidase-like
FT                   glycosyl hydrolase; PFAM: Glycosyl hydrolase family 3 N
FT                   terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13322"
FT                   /db_xref="GOA:D7CXW2"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXW2"
FT                   /protein_id="ADI13322.1"
FT                   /translation="MTDALLMIDLKQPRLTPDERAFLGERRVGGVCLFARNVEDRVQLG
FT                   ELTAELRALLGPDVLIAVDQEGGAVVRVRDVPYPPSMMALGAADDLGLTRKMGAMSARG
FT                   LRAVGVNVNFAPVADVNHNPRNPVIAERAFGGDPEAVARHVAAFVAGHQEAGVGAVVKH
FT                   FPGHGDTDLDSHLELPHLAADAARLERLELPPFRRAVAAGVAGVMSAHIVLPALDPALP
FT                   ATLSRAVLTGLLRERLGFDGVIFTDALDMRAIAASFAPAEAALRAVAAGADMALYLGPL
FT                   KEHEAILRRLEAGLASGELDPEAVARARARLRALARRFPVAPAPEAAWEVGDEARLEAA
FT                   AFRGTVALGELPKLEPGARVTLVAAAAVAAGGASSAVRAPAEALAAALEGAGVRVTRAF
FT                   YARGAEGASVLGALAGAELVLFASTSRTRMEGAELALARAVARAVRPPQRFVHVALWNP
FT                   YHALDLPGPALLTFGFRGPSARAAARALLEGGAPGRLPVALEVARGPYA"
     MTDALLMIDL KQPRLTPDER AFLGERRVGG VCLFARNVED RVQLGELTAE LRALLGPDVL        60
     IAVDQEGGAV VRVRDVPYPP SMMALGAADD LGLTRKMGAM SARGLRAVGV NVNFAPVADV       120
     NHNPRNPVIA ERAFGGDPEA VARHVAAFVA GHQEAGVGAV VKHFPGHGDT DLDSHLELPH       180
     LAADAARLER LELPPFRRAV AAGVAGVMSA HIVLPALDPA LPATLSRAVL TGLLRERLGF       240
     DGVIFTDALD MRAIAASFAP AEAALRAVAA GADMALYLGP LKEHEAILRR LEAGLASGEL       300
     DPEAVARARA RLRALARRFP VAPAPEAAWE VGDEARLEAA AFRGTVALGE LPKLEPGARV       360
     TLVAAAAVAA GGASSAVRAP AEALAAALEG AGVRVTRAFY ARGAEGASVL GALAGAELVL       420
     FASTSRTRME GAELALARAV ARAVRPPQRF VHVALWNPYH ALDLPGPALL TFGFRGPSAR       480
     AAARALLEGG APGRLPVALE VARGPYA                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page