(data stored in ACNUC30630 zone)

EMBL: CP002049.PE188

CP002049.PE188       Location/Qualifiers
FT   CDS             217143..218909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0190"
FT                   /product="TrkA-C domain protein"
FT                   /note="COGs: COG0471 Di- and tricarboxylate transporter;
FT                   InterPro IPR006037:IPR004680:IPR016040:IPR001898; KEGG:
FT                   noc:Noc_1175 TrkA-C, di- and tricarboxylate transporters;
FT                   PFAM: TrkA-C domain protein; Citrate transporter; SPTR:
FT                   Q3JBW8 TrkA-C, di-and tricarboxylate transporters; PFAM:
FT                   TrkA-C domain; Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13331"
FT                   /db_xref="GOA:D7CXX1"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXX1"
FT                   /protein_id="ADI13331.1"
FT                   /translation="MSWEAWFSVFVILFNVGLLIFTRVGADIVLVSGVTLLLLTGILTP
FT                   SEALSGLANEGMVTVGVLYVVVAGLRETGAIGWLGTRLFGRPKSLPGAQLRMMAPITAL
FT                   SAVLNNTPLVAMMIPAVGDWAKRQNLAPSKLMIPLSYAAILGGTCSLIGTSTNLVVYGL
FT                   MTERTELRFGLFDIAWVGVPCAVVGITLVVLFHRWLLPDRRSAIGQQGDPREYTVEMLV
FT                   EEGGPLVGKTIEEAGLRSLPQLYLAEIDRGGRVIPAVGPQELLQGGDRLLFVGIVESVV
FT                   DLHKVRGLIPAPDQLFKVTTPRPRRILVEAVVSNTAPLVGKSVREGRFRSLYNAVIIAV
FT                   ARNGERINRKIGDIVLQPGDTLLLEASPEFAQAHRNSRDFFLVSRIENSNPPRHERALL
FT                   ALGILLGMVATVTLGWLSMLQAALLAAGLMLVTRCITGSVARRSVDWQVLIVIAASFGL
FT                   GRALEVTGAAETIASSLVALAGGDPYLSLVMIYLITMLFTELITNNGAAVLMFPIALAT
FT                   ATGLGANFAPFAICIMMAASASFSTPIGYQTNLMVYGPGGYKFTDYFRAGIPMNLTMAA
FT                   VTLLIAPRVWPL"
     MSWEAWFSVF VILFNVGLLI FTRVGADIVL VSGVTLLLLT GILTPSEALS GLANEGMVTV        60
     GVLYVVVAGL RETGAIGWLG TRLFGRPKSL PGAQLRMMAP ITALSAVLNN TPLVAMMIPA       120
     VGDWAKRQNL APSKLMIPLS YAAILGGTCS LIGTSTNLVV YGLMTERTEL RFGLFDIAWV       180
     GVPCAVVGIT LVVLFHRWLL PDRRSAIGQQ GDPREYTVEM LVEEGGPLVG KTIEEAGLRS       240
     LPQLYLAEID RGGRVIPAVG PQELLQGGDR LLFVGIVESV VDLHKVRGLI PAPDQLFKVT       300
     TPRPRRILVE AVVSNTAPLV GKSVREGRFR SLYNAVIIAV ARNGERINRK IGDIVLQPGD       360
     TLLLEASPEF AQAHRNSRDF FLVSRIENSN PPRHERALLA LGILLGMVAT VTLGWLSMLQ       420
     AALLAAGLML VTRCITGSVA RRSVDWQVLI VIAASFGLGR ALEVTGAAET IASSLVALAG       480
     GDPYLSLVMI YLITMLFTEL ITNNGAAVLM FPIALATATG LGANFAPFAI CIMMAASASF       540
     STPIGYQTNL MVYGPGGYKF TDYFRAGIPM NLTMAAVTLL IAPRVWPL                    588
//

If you have problems or comments...

PBIL Back to PBIL home page