(data stored in ACNUC30630 zone)

EMBL: CP002049.PE191

CP002049.PE191       Location/Qualifiers
FT   CDS             complement(222104..222367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddr:Deide_07260 putative ABC transporter,
FT                   ATP-binding component; SPTR: C1D160 Putative ABC
FT                   transporter, ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13334"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXX4"
FT                   /protein_id="ADI13334.1"
FT                   /translation="MAWEYLQVMMTTKPVKEGHSRLIVLGRGQEQAPIGAGTRLVDLLN
FT                   DLGAQGWELAGVLNLSSVDEPKAAHELHLTNSSLIFKRPLNP"
     MAWEYLQVMM TTKPVKEGHS RLIVLGRGQE QAPIGAGTRL VDLLNDLGAQ GWELAGVLNL        60
     SSVDEPKAAH ELHLTNSSLI FKRPLNP                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page