(data stored in ACNUC30630 zone)

EMBL: CP002049.PE20

CP002049.PE20        Location/Qualifiers
FT   CDS             complement(23227..24087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0020"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_6160 allergen V5/TPX-1 family
FT                   protein; SPTR: Q01TD4 Allergen V5/Tpx-1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13163"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWS2"
FT                   /protein_id="ADI13163.1"
FT                   /translation="MRRRYWYVLLCPLAALAAYARPLQRPPSPPELTLGASEEVVRPGE
FT                   AVTLTWSLRSGAGWRTALLPGVGPTSETAATVRPRLSTTYTLLAQRQGSSVQRDVRVEV
FT                   QSAPQGAAPGAPVTGGADVAPREGSEQERDEAPSGTFGVSARAEGPFLNDRAGGIAAPD
FT                   DERIVRVAPGESFYAQASFRDPDGIAEVVINLVNSSPEGLAGNLAPTRGPFTLEGEPQG
FT                   ACNLLALPTEVRCVFEIRVAEDAQNIDALPGAGDEFAYVFRVRVTDNLGNSANRPIRGY
FT                   VIVEP"
     MRRRYWYVLL CPLAALAAYA RPLQRPPSPP ELTLGASEEV VRPGEAVTLT WSLRSGAGWR        60
     TALLPGVGPT SETAATVRPR LSTTYTLLAQ RQGSSVQRDV RVEVQSAPQG AAPGAPVTGG       120
     ADVAPREGSE QERDEAPSGT FGVSARAEGP FLNDRAGGIA APDDERIVRV APGESFYAQA       180
     SFRDPDGIAE VVINLVNSSP EGLAGNLAPT RGPFTLEGEP QGACNLLALP TEVRCVFEIR       240
     VAEDAQNIDA LPGAGDEFAY VFRVRVTDNL GNSANRPIRG YVIVEP                      286
//

If you have problems or comments...

PBIL Back to PBIL home page