(data stored in ACNUC30630 zone)

EMBL: CP002049.PE209

CP002049.PE209       Location/Qualifiers
FT   CDS             247231..248259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0212"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="COGs: COG1064 Zn-dependent alcohol dehydrogenase;
FT                   InterProIPR013154:IPR013149:IPR011032:IPR016040:IPR 002328;
FT                   KEGG: ddr:Deide_03550 putative alcohol dehydrogenase,
FT                   (ADH); PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; SPTR:
FT                   C1CZS5 Putative Alcohol dehydrogenase, (ADH); PFAM: Alcohol
FT                   dehydrogenase GroES-like domain; Zinc-binding
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13352"
FT                   /db_xref="GOA:D7CXZ2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXZ2"
FT                   /protein_id="ADI13352.1"
FT                   /translation="MKAALMHAFREPLRVTDVPDPEPPAGGVVIRVGACGVCRSDWHAW
FT                   MGHDPTIRLPHVPGHELAGTVAALGAGVTHWRVGERVTVPFCCGCGRCQTCRAGYPHVC
FT                   DAEYQPGFTGWGAFAEYVALPYAEVNLVRLPDALGFVEAASLGCRFMTAFHALTAQGRV
FT                   QPGEWVAVHGCGGVGLSAVMIAAALGARVVAVDLDDAKLERARALGAEHVLRSAHPVGA
FT                   ILELTQGGAHVSLDALGSAATLRNSVRCLRKKGRHVQVGLLLGESRPTALPMGEVIAKE
FT                   LELRGSHGMPAHAYPQMLRMIAEGTLAPQRLVGKTLTLEEAGAELAAMGRFAPRGVSVI
FT                   VL"
     MKAALMHAFR EPLRVTDVPD PEPPAGGVVI RVGACGVCRS DWHAWMGHDP TIRLPHVPGH        60
     ELAGTVAALG AGVTHWRVGE RVTVPFCCGC GRCQTCRAGY PHVCDAEYQP GFTGWGAFAE       120
     YVALPYAEVN LVRLPDALGF VEAASLGCRF MTAFHALTAQ GRVQPGEWVA VHGCGGVGLS       180
     AVMIAAALGA RVVAVDLDDA KLERARALGA EHVLRSAHPV GAILELTQGG AHVSLDALGS       240
     AATLRNSVRC LRKKGRHVQV GLLLGESRPT ALPMGEVIAK ELELRGSHGM PAHAYPQMLR       300
     MIAEGTLAPQ RLVGKTLTLE EAGAELAAMG RFAPRGVSVI VL                          342
//

If you have problems or comments...

PBIL Back to PBIL home page