(data stored in ACNUC30630 zone)

EMBL: CP002049.PE213

CP002049.PE213       Location/Qualifiers
FT   CDS             complement(250498..251028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0216"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="COGs: COG2197 Response regulator containing a
FT                   CheY-like receiver domain and an HTH DNA-binding domain;
FT                   InterPro IPR000792:IPR016032:IPR011991; KEGG: sgr:SGR_4042
FT                   putative two-component system response regulator; PFAM:
FT                   regulatory protein LuxR; SMART: regulatory protein LuxR;
FT                   SPTR: B4CWX5 Two component transcriptional regulator, LuxR
FT                   family; PFAM: Bacterial regulatory proteins, luxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13356"
FT                   /db_xref="GOA:D7CXZ6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXZ6"
FT                   /protein_id="ADI13356.1"
FT                   /translation="MHVWVFSDVRLLQRGLIELVTHLGFTAHAIHTPEVEVALWHLKRT
FT                   APPFPPPPPLPTLALFSGTEDDVIRLLQRGYRGYLSPQDDDAQLFKALQALRRGEIWAS
FT                   RELLTRTIGSLSTPQLTEREREVLGLLAQGLSNRAIGERLGISERTVKTHVANLFDKFG
FT                   VRTRLELAAQVQP"
     MHVWVFSDVR LLQRGLIELV THLGFTAHAI HTPEVEVALW HLKRTAPPFP PPPPLPTLAL        60
     FSGTEDDVIR LLQRGYRGYL SPQDDDAQLF KALQALRRGE IWASRELLTR TIGSLSTPQL       120
     TEREREVLGL LAQGLSNRAI GERLGISERT VKTHVANLFD KFGVRTRLEL AAQVQP           176
//

If you have problems or comments...

PBIL Back to PBIL home page