(data stored in ACNUC30630 zone)

EMBL: CP002049.PE217

CP002049.PE217       Location/Qualifiers
FT   CDS             256803..257717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0220"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847:IPR005119:IPR011991; KEGG: sru:SRU_2406
FT                   redox-sensitive transcriptional activator OxyR; PFAM: LysR
FT                   substrate-binding; regulatory protein LysR; SPTR: Q2RZX6
FT                   Redox-sensitive transcriptional activator OxyR; PFAM:
FT                   Bacterial regulatory helix-turn-helix protein, lysR family;
FT                   LysR substrate binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13360"
FT                   /db_xref="GOA:D7CY00"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY00"
FT                   /protein_id="ADI13360.1"
FT                   /translation="MTLTQLKYLVAVAETGHFAEAAQRCGVTQPTLSMQLQKLERSLGI
FT                   VLFDRRKKPVEPTEAGATLVAQARRVLHECARLEGLAQEARGTVTGELRLGILPTLAPY
FT                   LLPLVVPRFLRRYPGVHLRVREATTAQLIGELVGNGLDLGLASDHEPHAALLSQPLFRE
FT                   PFVAFLAPEHRLAPHREIPTSALHVSDMWLLSEGHCLRDQTLRLCRGGELACGTRRSLH
FT                   FESGNLQTLVKLVKQSGGMTLLPLLATLDLSDGERRTYVRPLVPTPQREVWALTSRTSA
FT                   QRPLFRAFITTVLEALPENLAAL"
     MTLTQLKYLV AVAETGHFAE AAQRCGVTQP TLSMQLQKLE RSLGIVLFDR RKKPVEPTEA        60
     GATLVAQARR VLHECARLEG LAQEARGTVT GELRLGILPT LAPYLLPLVV PRFLRRYPGV       120
     HLRVREATTA QLIGELVGNG LDLGLASDHE PHAALLSQPL FREPFVAFLA PEHRLAPHRE       180
     IPTSALHVSD MWLLSEGHCL RDQTLRLCRG GELACGTRRS LHFESGNLQT LVKLVKQSGG       240
     MTLLPLLATL DLSDGERRTY VRPLVPTPQR EVWALTSRTS AQRPLFRAFI TTVLEALPEN       300
     LAAL                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page