(data stored in ACNUC30630 zone)

EMBL: CP002049.PE221

CP002049.PE221       Location/Qualifiers
FT   CDS             complement(260762..261934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0224"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR005467:IPR003661:IPR003594:IPR004358:IPR 009082;
FT                   KEGG: dal:Dalk_0313 histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SPTR: C1XF72 Sensor
FT                   protein; PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13364"
FT                   /db_xref="GOA:D7CY04"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY04"
FT                   /protein_id="ADI13364.1"
FT                   /translation="MKRLRLTSQTATRIAFGVVVVFLLAQVTWWIVFQQRYIARVTRET
FT                   LSAWQRDAATVNLLLAFDDESAVRAQIEATYPHLRLVSTPEGFVRAEVDPAQLRAFRDA
FT                   QTGHLRMFAFEGPFYVLVMLAGLYFIALSLRAERDLKRRQQNFLNAVSHEFKTPLSTLK
FT                   LLLESVLYRSLSPAKQRDYLERMNSELRRLEATSEQVLAAARLEHALAVSRLREVDLND
FT                   ALREALAPLQGGLEARGARLKVHYCPEALPVSLDPAAFAIVLNNLLDNAVKYTPEADKP
FT                   ITIRLEGQRHLAVLHVEDRGVGLREGERRRIFDPFYRVGDELTRATSGVGLGLHLVRSV
FT                   TEVMNGWVRCDAPLDPRTGRGSRFSVVLPKRVGAATPERTPSLTPQDMTR"
     MKRLRLTSQT ATRIAFGVVV VFLLAQVTWW IVFQQRYIAR VTRETLSAWQ RDAATVNLLL        60
     AFDDESAVRA QIEATYPHLR LVSTPEGFVR AEVDPAQLRA FRDAQTGHLR MFAFEGPFYV       120
     LVMLAGLYFI ALSLRAERDL KRRQQNFLNA VSHEFKTPLS TLKLLLESVL YRSLSPAKQR       180
     DYLERMNSEL RRLEATSEQV LAAARLEHAL AVSRLREVDL NDALREALAP LQGGLEARGA       240
     RLKVHYCPEA LPVSLDPAAF AIVLNNLLDN AVKYTPEADK PITIRLEGQR HLAVLHVEDR       300
     GVGLREGERR RIFDPFYRVG DELTRATSGV GLGLHLVRSV TEVMNGWVRC DAPLDPRTGR       360
     GSRFSVVLPK RVGAATPERT PSLTPQDMTR                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page