(data stored in ACNUC30630 zone)

EMBL: CP002049.PE224

CP002049.PE224       Location/Qualifiers
FT   CDS             complement(263798..264760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0227"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="COGs: COG0181 Porphobilinogen deaminase; InterPro
FT                   IPR000860; KEGG: phe:Phep_3450 porphobilinogen deaminase;
FT                   PFAM: Porphobilinogen deaminase; SPTR: C1XF75
FT                   Porphobilinogen deaminase; TIGRFAM: porphobilinogen
FT                   deaminase; PFAM: Porphobilinogen deaminase, C-terminal
FT                   domain; Porphobilinogen deaminase, dipyromethane cofactor
FT                   binding domain; TIGRFAM: porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13367"
FT                   /db_xref="GOA:D7CY07"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY07"
FT                   /protein_id="ADI13367.1"
FT                   /translation="MSRSFSPLADLPRARYTGVVRIATRKSALALWQATWVRERLAALG
FT                   VATELVPLDTQGDRTQEAGTPFRLMPGQGFFTKAVQDAVLEGRADVAVHSHKDLPSARL
FT                   AGLELAAVTEREDPRDVLLVRPGAARPESAALPLVEGAVVGTSAARRQAQLRHLRPDVR
FT                   VAELRGNVPTRVRALREGRYDAVVLAAAGLARLALDLSDLTVYPLDPKRFVPAPAQGAL
FT                   ALEIRRGDAELAALLTELHAPDAYQTVAAERGLMGMLQGGCQLALGAYAALQGGELELT
FT                   AWYEGERVTVKHRSAEGAAYLAFDALGRPAPARAAAKEP"
     MSRSFSPLAD LPRARYTGVV RIATRKSALA LWQATWVRER LAALGVATEL VPLDTQGDRT        60
     QEAGTPFRLM PGQGFFTKAV QDAVLEGRAD VAVHSHKDLP SARLAGLELA AVTEREDPRD       120
     VLLVRPGAAR PESAALPLVE GAVVGTSAAR RQAQLRHLRP DVRVAELRGN VPTRVRALRE       180
     GRYDAVVLAA AGLARLALDL SDLTVYPLDP KRFVPAPAQG ALALEIRRGD AELAALLTEL       240
     HAPDAYQTVA AERGLMGMLQ GGCQLALGAY AALQGGELEL TAWYEGERVT VKHRSAEGAA       300
     YLAFDALGRP APARAAAKEP                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page