(data stored in ACNUC30630 zone)

EMBL: CP002049.PE231

CP002049.PE231       Location/Qualifiers
FT   CDS             270513..270914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0234"
FT                   /product="thioesterase superfamily protein"
FT                   /note="COGs: COG0824 thioesterase; InterPro IPR006683;
FT                   KEGG: sde:Sde_1856 hypothetical protein; PFAM: thioesterase
FT                   superfamily protein; SPTR: Q21JL3 Thioesterase superfamily;
FT                   PFAM: Thioesterase superfamily; TIGRFAM: conserved
FT                   hypothetical protein TIGR00051"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13374"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY14"
FT                   /protein_id="ADI13374.1"
FT                   /translation="MEPFRTDIQVRFSDTDALGHLNNIAYALYAEQARVDLFNRVLPRE
FT                   GRGSVFVILAHIALDFLRQIRFGEAVYVMTRVSKLGRTSVTLDQEVYADDELAAKVRSV
FT                   VVLFDFKAQQPTPLPEALRAQLEPAKEPA"
     MEPFRTDIQV RFSDTDALGH LNNIAYALYA EQARVDLFNR VLPREGRGSV FVILAHIALD        60
     FLRQIRFGEA VYVMTRVSKL GRTSVTLDQE VYADDELAAK VRSVVVLFDF KAQQPTPLPE       120
     ALRAQLEPAK EPA                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page