(data stored in ACNUC30630 zone)

EMBL: CP002049.PE235

CP002049.PE235       Location/Qualifiers
FT   CDS             complement(274208..274459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dge:Dgeo_0322 hypothetical protein; SPTR:
FT                   Q1J1K9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13378"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY18"
FT                   /protein_id="ADI13378.1"
FT                   /translation="MSKELIESFLQGMRERHAEEIEAIELPEGTEAYLENRIQAGDVAT
FT                   LTFMIKLAYLMGLHTGYAAGAGGSGTTPPPPQRGPLQA"
     MSKELIESFL QGMRERHAEE IEAIELPEGT EAYLENRIQA GDVATLTFMI KLAYLMGLHT        60
     GYAAGAGGSG TTPPPPQRGP LQA                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page