(data stored in ACNUC30630 zone)

EMBL: CP002049.PE238

CP002049.PE238       Location/Qualifiers
FT   CDS             complement(280250..280921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0241"
FT                   /product="TrkA-N domain protein"
FT                   /note="COGs: COG0569 K+ transport systems NAD-binding
FT                   component; InterPro IPR003148:IPR006037:IPR016040; KEGG:
FT                   dge:Dgeo_1584 TrkA-N; PFAM: TrkA-N domain protein; TrkA-C
FT                   domain protein; SPTR: Q1IY05 K+ transport system,
FT                   NAD-binding component; PFAM: TrkA-N domain; TrkA-C domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13381"
FT                   /db_xref="GOA:D7CY21"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY21"
FT                   /protein_id="ADI13381.1"
FT                   /translation="MKAKQFLVIGAGRFGSALATTLYEFGHEVVVVDRSEERVERIMDR
FT                   VTHAVILDATDEEALAKLGLNTFDRVVVAIGNNLEASILSIVAAKNRGASYVISKATSE
FT                   IAARVMLKVGADQVVRPEHDMGVRVAKTLATPSIVDAFPLGENYEVIEFQAQRNLCGKL
FT                   RDLKLANRFGVEVIAVNRNGKLELRPGPDFVVSPGDNVVLIGETRALKRLRDHFARVSA
FT                   A"
     MKAKQFLVIG AGRFGSALAT TLYEFGHEVV VVDRSEERVE RIMDRVTHAV ILDATDEEAL        60
     AKLGLNTFDR VVVAIGNNLE ASILSIVAAK NRGASYVISK ATSEIAARVM LKVGADQVVR       120
     PEHDMGVRVA KTLATPSIVD AFPLGENYEV IEFQAQRNLC GKLRDLKLAN RFGVEVIAVN       180
     RNGKLELRPG PDFVVSPGDN VVLIGETRAL KRLRDHFARV SAA                         223
//

If you have problems or comments...

PBIL Back to PBIL home page