(data stored in ACNUC30630 zone)

EMBL: CP002049.PE239

CP002049.PE239       Location/Qualifiers
FT   CDS             complement(280997..282355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0242"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /EC_number="3.6.3.14"
FT                   /note="COGs: COG0168 Trk-type K+ transport systems membrane
FT                   components; InterPro IPR004772:IPR003445; KEGG:
FT                   dge:Dgeo_1583 K+ transporter trk; PFAM: cation transporter;
FT                   PRIAM: H(+)-transporting two-sector ATPase; SPTR: Q1IY06 K+
FT                   transporter Trk; TIGRFAM: potassium uptake protein, TrkH
FT                   family; PFAM: Cation transport protein; TIGRFAM: potassium
FT                   uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13382"
FT                   /db_xref="GOA:D7CY22"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY22"
FT                   /protein_id="ADI13382.1"
FT                   /translation="MVDRGSIRPPRRAAPSPAKIIALYFVSAIAVGTLLLWLPISHAPG
FT                   AEIGLLEALFTATSALCVTGLVVVDTATAWSIFGKVVIMLLIQVGGLGIVTLGTLVALL
FT                   LGRRVGFRERLRAAAQVNALQTGGIVKLVRTIFLISLGFEAVGALLLYPTFAALHGPGM
FT                   GAFYAFFHAVSAFNNAGFALYSENLTGFVRDPTVNLVLAALFITGGLGFLVHLNLWARL
FT                   RHGSHFQLTLQSRFVLLTSLGLGLLGWVAVCLFEWTNPQTLGALPWPSRLLAGFFQGVT
FT                   PRTAGFNTLDYAQVREPTLLVTMALMFIGGSPGSTAGGIKTVTFAVLAASAWSMVRGRG
FT                   ELTAFGRRVTTETVVKAGSVALLSLGIVFGAMLLLSISETVPLVPLMFEAFSAFGTVGL
FT                   SLNLTPELSAPGQLIVTLLMYLGRIGPLTFAVALVQEPRDSPITYPDEGVMIG"
     MVDRGSIRPP RRAAPSPAKI IALYFVSAIA VGTLLLWLPI SHAPGAEIGL LEALFTATSA        60
     LCVTGLVVVD TATAWSIFGK VVIMLLIQVG GLGIVTLGTL VALLLGRRVG FRERLRAAAQ       120
     VNALQTGGIV KLVRTIFLIS LGFEAVGALL LYPTFAALHG PGMGAFYAFF HAVSAFNNAG       180
     FALYSENLTG FVRDPTVNLV LAALFITGGL GFLVHLNLWA RLRHGSHFQL TLQSRFVLLT       240
     SLGLGLLGWV AVCLFEWTNP QTLGALPWPS RLLAGFFQGV TPRTAGFNTL DYAQVREPTL       300
     LVTMALMFIG GSPGSTAGGI KTVTFAVLAA SAWSMVRGRG ELTAFGRRVT TETVVKAGSV       360
     ALLSLGIVFG AMLLLSISET VPLVPLMFEA FSAFGTVGLS LNLTPELSAP GQLIVTLLMY       420
     LGRIGPLTFA VALVQEPRDS PITYPDEGVM IG                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page