(data stored in ACNUC30630 zone)

EMBL: CP002049.PE247

CP002049.PE247       Location/Qualifiers
FT   CDS             complement(292766..293422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0250"
FT                   /product="MOSC domain containing protein"
FT                   /note="COGs: COG2258 conserved hypothetical protein;
FT                   InterPro IPR005302:IPR011037:IPR015808; KEGG: dra:DR_1051
FT                   hypothetical protein; PFAM: MOSC domain containing protein;
FT                   SPTR: C1XRA3 Uncharacterized conserved protein; PFAM: MOSC
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13390"
FT                   /db_xref="GOA:D7CY30"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY30"
FT                   /protein_id="ADI13390.1"
FT                   /translation="MQLLSVNVGQARAIVAKSGRSGIFKRATTERVRVTRDGLLGDTIC
FT                   DTENHGGPDQAVYLYGAPDYAWWSEQLGRTLAPGTFGENLTVSGLESATLQVGDRFRVG
FT                   EVVLEVTAPRIPCVTLAVRMGDPAFVKRFRHAERPGVYCRVLHEGDVWAGAEVRLEPYT
FT                   GATVGVLELFRDFFRPERDEKTLRRHLAAPIASRDRAAKEAALAALRERGDPHAP"
     MQLLSVNVGQ ARAIVAKSGR SGIFKRATTE RVRVTRDGLL GDTICDTENH GGPDQAVYLY        60
     GAPDYAWWSE QLGRTLAPGT FGENLTVSGL ESATLQVGDR FRVGEVVLEV TAPRIPCVTL       120
     AVRMGDPAFV KRFRHAERPG VYCRVLHEGD VWAGAEVRLE PYTGATVGVL ELFRDFFRPE       180
     RDEKTLRRHL AAPIASRDRA AKEAALAALR ERGDPHAP                               218
//

If you have problems or comments...

PBIL Back to PBIL home page