(data stored in ACNUC30630 zone)

EMBL: CP002049.PE25

CP002049.PE25        Location/Qualifiers
FT   CDS             27179..27751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0025"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="COGs: COG1057 Nicotinic acid mononucleotide
FT                   adenylyltransferase; InterPro
FT                   IPR004821:IPR005248:IPR004820:IPR014729; KEGG: ttj:TTHA1780
FT                   nicotinic acid mononucleotide adenylyltransferase; PFAM:
FT                   cytidylyltransferase; PRIAM: Nicotinate-nucleotide
FT                   adenylyltransferase; SPTR: B7A5T9 Nicotinate (Nicotinamide)
FT                   nucleotide adenylyltransferase; TIGRFAM: nicotinate
FT                   (nicotinamide) nucleotide adenylyltransferase;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   Cytidylyltransferase; TIGRFAM: nicotinate (nicotinamide)
FT                   nucleotide adenylyltransferase; cytidyltransferase-related
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13168"
FT                   /db_xref="GOA:D7CWS7"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWS7"
FT                   /protein_id="ADI13168.1"
FT                   /translation="MRLGLFGGRFDPPHIGHLLAAQGALEALALDELWFVPAKAPPHKP
FT                   TCAGAEDRYQMLVLATLTHPQLRVSRLELERRGVSYTFDTAVQVRAQHPDARLFFITGA
FT                   DAYAEIASWHRAAELVRLVNMVAIPRPGYTLSNVASPFKEAVYPLALRACDVSSTEIRN
FT                   RLAQGRSVRYLVPELVETYLEKHALYR"
     MRLGLFGGRF DPPHIGHLLA AQGALEALAL DELWFVPAKA PPHKPTCAGA EDRYQMLVLA        60
     TLTHPQLRVS RLELERRGVS YTFDTAVQVR AQHPDARLFF ITGADAYAEI ASWHRAAELV       120
     RLVNMVAIPR PGYTLSNVAS PFKEAVYPLA LRACDVSSTE IRNRLAQGRS VRYLVPELVE       180
     TYLEKHALYR                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page