(data stored in ACNUC30630 zone)

EMBL: CP002049.PE253

CP002049.PE253       Location/Qualifiers
FT   CDS             complement(301045..301548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pjd:Pjdr2_0568 hypothetical protein; SPTR:
FT                   C6CRG5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13396"
FT                   /db_xref="GOA:D7CY36"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY36"
FT                   /protein_id="ADI13396.1"
FT                   /translation="MPAAHPHAVGRAVRVRLTRDDVMYYTWVQALARPVLPFLLYSFVL
FT                   LTFASILGLWPAGRAFALAALVPLLGYLLWVWLVGRGLWSKYPQLRAPRTYRFDEAGYT
FT                   IQTPENTVKVRYDELSRLVSSRRALYLVRRDGSADILPRSALPEGLEGWLQAKVPETER
FT                   SSFL"
     MPAAHPHAVG RAVRVRLTRD DVMYYTWVQA LARPVLPFLL YSFVLLTFAS ILGLWPAGRA        60
     FALAALVPLL GYLLWVWLVG RGLWSKYPQL RAPRTYRFDE AGYTIQTPEN TVKVRYDELS       120
     RLVSSRRALY LVRRDGSADI LPRSALPEGL EGWLQAKVPE TERSSFL                     167
//

If you have problems or comments...

PBIL Back to PBIL home page