(data stored in ACNUC30630 zone)

EMBL: CP002049.PE257

CP002049.PE257       Location/Qualifiers
FT   CDS             complement(304851..305168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0260"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain protein"
FT                   /note="COGs: COG2146 Ferredoxin subunits of nitrite
FT                   reductase and ring-hydroxylating dioxygenase; InterPro
FT                   IPR017941; KEGG: ddr:Deide_16700 putative benzene
FT                   1,2-dioxygenase system ferredoxin subunit; PFAM: Rieske
FT                   [2Fe-2S] iron-sulphur domain; SPTR: C1CWS4 Putative benzene
FT                   1,2-dioxygenase system ferredoxin subunit; PFAM: Rieske
FT                   [2Fe-2S] domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13400"
FT                   /db_xref="GOA:D7CY40"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D7CY40"
FT                   /protein_id="ADI13400.1"
FT                   /translation="MTENLIDVGAASDFPDNTMHPLELAGRSVLLVHQGGRFYALENRC
FT                   THKAYPLHTGELLEGAVKCEWHGAKFNLETGKPTLPAVKKVRLYDVRVQDGRVLVAIQE
FT                   A"
     MTENLIDVGA ASDFPDNTMH PLELAGRSVL LVHQGGRFYA LENRCTHKAY PLHTGELLEG        60
     AVKCEWHGAK FNLETGKPTL PAVKKVRLYD VRVQDGRVLV AIQEA                       105
//

If you have problems or comments...

PBIL Back to PBIL home page