(data stored in ACNUC30630 zone)

EMBL: CP002049.PE281

CP002049.PE281       Location/Qualifiers
FT   CDS             331829..332881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0284"
FT                   /product="radical SAM domain-containing protein"
FT                   /note="COGs: COG1533 DNA repair photolyase; KEGG:
FT                   mch:Mchl_3457 radical SAM domain-containing protein; SPTR:
FT                   B7KUP8 Radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13424"
FT                   /db_xref="InterPro:IPR023805"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR24"
FT                   /protein_id="ADI13424.1"
FT                   /translation="MLRVSRIFLEREALAYPRAHDHDILARFPDAERVEVASHWNIPGL
FT                   HGNEGLVRDWVRVKRTVLVLGVRKTFPVRPNGRSADFIAPGFASGCAMACAYCYVPRRK
FT                   GFANPISTFVNLEAIHRAVGRHAAKQGPKKPAQTDPAAWVYDIGENSDVSVDALVSDNV
FT                   RDTVAFFRTLPGAKASFATKYVNRALLSYDPQGRTRVRFSLMPQRVAKTVDVRTSPVGE
FT                   RIGAINDFVAAGYEVHLNFSPVILYEGWRRDYAELFEQLDDVLSDEAKAQLKAEVIFLT
FT                   HNALLHEVNLGWHPKAEALLWTPETQEAKTSQMGGENVRYRHGFKGKQVAALRDLLARK
FT                   MPYCAVRYAF"
     MLRVSRIFLE REALAYPRAH DHDILARFPD AERVEVASHW NIPGLHGNEG LVRDWVRVKR        60
     TVLVLGVRKT FPVRPNGRSA DFIAPGFASG CAMACAYCYV PRRKGFANPI STFVNLEAIH       120
     RAVGRHAAKQ GPKKPAQTDP AAWVYDIGEN SDVSVDALVS DNVRDTVAFF RTLPGAKASF       180
     ATKYVNRALL SYDPQGRTRV RFSLMPQRVA KTVDVRTSPV GERIGAINDF VAAGYEVHLN       240
     FSPVILYEGW RRDYAELFEQ LDDVLSDEAK AQLKAEVIFL THNALLHEVN LGWHPKAEAL       300
     LWTPETQEAK TSQMGGENVR YRHGFKGKQV AALRDLLARK MPYCAVRYAF                  350
//

If you have problems or comments...

PBIL Back to PBIL home page