(data stored in ACNUC30630 zone)

EMBL: CP002049.PE302

CP002049.PE302       Location/Qualifiers
FT   CDS             354798..355160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ttj:TTHB064 hypothetical protein; SPTR: Q746N2
FT                   Hypothetical conserved protein; manually curated; PFAM:
FT                   Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13445"
FT                   /db_xref="GOA:D7CR45"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D7CR45"
FT                   /protein_id="ADI13445.1"
FT                   /translation="MRRLSLSSVQVFYPAWTAATLTETLKQRVAQLHEVLPLKQAVLFG
FT                   SWSKGRATVASDIDVLLVYRGEAREGCYALAWRTLAVPGIELHLYSEAEAAEHEKLLSE
FT                   MTAGGITLFEPPQGPL"
     MRRLSLSSVQ VFYPAWTAAT LTETLKQRVA QLHEVLPLKQ AVLFGSWSKG RATVASDIDV        60
     LLVYRGEARE GCYALAWRTL AVPGIELHLY SEAEAAEHEK LLSEMTAGGI TLFEPPQGPL       120
//

If you have problems or comments...

PBIL Back to PBIL home page