(data stored in ACNUC30630 zone)

EMBL: CP002049.PE310

CP002049.PE310       Location/Qualifiers
FT   CDS             complement(363355..364341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0314"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683:IPR004104:IPR016040; KEGG: tai:Taci_0947
FT                   oxidoreductase domain protein; PFAM: oxidoreductase domain
FT                   protein; Oxidoreductase domain; SPTR: C1XSC0 Predicted
FT                   dehydrogenase; PFAM: Oxidoreductase family, C-terminal
FT                   alpha/beta domain; Oxidoreductase family, NAD-binding
FT                   Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13453"
FT                   /db_xref="GOA:D7CRG3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRG3"
FT                   /protein_id="ADI13453.1"
FT                   /translation="MKRLKVAVVGFGVMGRNHAGVYAVLPHTDLVAVVDPSEERRAEAA
FT                   QRFAVQTFPDVGAMLARLGGQLDAVSVAAPTSYHYPLTETLLKAGLHVLVEKPVATNVQ
FT                   HAERLVALSRRLGLTLQVGHITRFYQAVELLGKRITCPYLIEARRLTPNARIKDVGVIL
FT                   DLMIHDIDIVLGIVPGPITGVSVAGHVLNGDPHEDVAAAQITFQNGCIARFLASRVAPD
FT                   AERTLVVAEPQQTLRVDFGKEPHTEVSVYRPIAEAQGRSEVRLDRVVVHEDNPLRRELE
FT                   HFLARIRRSAPPIGTLDDDLRSLKLATQLIEQLKVQRYERGAVPVLA"
     MKRLKVAVVG FGVMGRNHAG VYAVLPHTDL VAVVDPSEER RAEAAQRFAV QTFPDVGAML        60
     ARLGGQLDAV SVAAPTSYHY PLTETLLKAG LHVLVEKPVA TNVQHAERLV ALSRRLGLTL       120
     QVGHITRFYQ AVELLGKRIT CPYLIEARRL TPNARIKDVG VILDLMIHDI DIVLGIVPGP       180
     ITGVSVAGHV LNGDPHEDVA AAQITFQNGC IARFLASRVA PDAERTLVVA EPQQTLRVDF       240
     GKEPHTEVSV YRPIAEAQGR SEVRLDRVVV HEDNPLRREL EHFLARIRRS APPIGTLDDD       300
     LRSLKLATQL IEQLKVQRYE RGAVPVLA                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page