(data stored in ACNUC30630 zone)

EMBL: CP002049.PE312

CP002049.PE312       Location/Qualifiers
FT   CDS             complement(365342..368206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0316"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) glucosamine
FT                   N-acyltransferase"
FT                   /note="COGs: COG1044 UDP-3-O-(3-hydroxymyristoyl); InterPro
FT                   IPR018357:IPR001451:IPR011004:IPR007691; KEGG:
FT                   mrd:Mrad2831_3438 UDP-3-O-(3-hydroxymyristoyl) glucosamine
FT                   N-acyltransferase; PFAM: transferase hexapeptide repeat
FT                   containing protein; SPTR: C1XGQ5
FT                   UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase;
FT                   TIGRFAM: UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase; TIGRFAM: UDP-3-O-[3-hydroxymyristoyl]
FT                   glucosamine N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13455"
FT                   /db_xref="GOA:D7CRG5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR008763"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRG5"
FT                   /protein_id="ADI13455.1"
FT                   /translation="MRPALRRLALLGALLLPTALAQGAAAPPPPAERAGDTPLFPLGAL
FT                   EAGARGYALTTGANNRPERLEVEVIALQYDLGTAFPLVLVETSGPLVERAGGIAAGMSG
FT                   SPVYLPYGGEDALLGAIGFTFPDGSGGLGLVTPIGAMRQAEAPEARPAAFGPPFDPRAA
FT                   APVRTPLLLEGLSGRAARLLGPLLAAQGLPATLQVPTRLQVQGRAGAPPHADADAAFEP
FT                   APGGAVSVQLVRGDLTVAAVGTLTLVEGGRFWAFGHPLLNQGEVSFALAPAYVTAVVPN
FT                   RTLPFKLADSGRRVLGAVTQDRPAALSGTLGEAPQFVPVTLTLQRGEAQASAHLEVTAL
FT                   EALFAPLLATASLQLLDDFLAETRGGTAELAWEIALRGGRTLRLLAQTTDPADIALVTA
FT                   ALAAEPLALLAENPFRAPGLGRVALHVALERDARVAEIADVVLEDAVVPAGGSVGVNVR
FT                   LQPFRQDPVVQRLSVPLPEALAGEVELTVRGGLSPLEADDAGAPPLSFEEFLAGLERSV
FT                   QARELVVEAFVGGELQLLTRQLLPHLVSGSVTRSVTVEGPADAADPAADTETDPETGGA
FT                   APPRRRHPTPRGAPLGRSPPHPAAGGPAVRPHPITAAQLAAQLGGRLEGDDRPVTALAD
FT                   PTAALPDSAVVVTSAAALEALSTQPVAAQLGALVLPDALCPAPRVACPIIWVRDVRLAL
FT                   ARLSALFAPPPPRPQLSDGAVVAPDATLGEAVSVGAGAVIGAGAVIGAGSRVGPGCVLG
FT                   EGVTLGPDCVLHANVTLYPGTALGARVIVHSGAVLGADGFGYAFGPQGAVKIHHLGGVV
FT                   IEDDVEVGANTCIDRGTLLDTRVGARTKIDNLCQIGHNVQIGPDCVIAGGSAIGGSTVL
FT                   ERGVLLGGAVAVTDHVRLGAGARVGGRSSVTKSVPAGETWAGYPAKPQRKWVRELYLIG
FT                   KLEAIWASVRAQGRPVSGARTGDD"
     MRPALRRLAL LGALLLPTAL AQGAAAPPPP AERAGDTPLF PLGALEAGAR GYALTTGANN        60
     RPERLEVEVI ALQYDLGTAF PLVLVETSGP LVERAGGIAA GMSGSPVYLP YGGEDALLGA       120
     IGFTFPDGSG GLGLVTPIGA MRQAEAPEAR PAAFGPPFDP RAAAPVRTPL LLEGLSGRAA       180
     RLLGPLLAAQ GLPATLQVPT RLQVQGRAGA PPHADADAAF EPAPGGAVSV QLVRGDLTVA       240
     AVGTLTLVEG GRFWAFGHPL LNQGEVSFAL APAYVTAVVP NRTLPFKLAD SGRRVLGAVT       300
     QDRPAALSGT LGEAPQFVPV TLTLQRGEAQ ASAHLEVTAL EALFAPLLAT ASLQLLDDFL       360
     AETRGGTAEL AWEIALRGGR TLRLLAQTTD PADIALVTAA LAAEPLALLA ENPFRAPGLG       420
     RVALHVALER DARVAEIADV VLEDAVVPAG GSVGVNVRLQ PFRQDPVVQR LSVPLPEALA       480
     GEVELTVRGG LSPLEADDAG APPLSFEEFL AGLERSVQAR ELVVEAFVGG ELQLLTRQLL       540
     PHLVSGSVTR SVTVEGPADA ADPAADTETD PETGGAAPPR RRHPTPRGAP LGRSPPHPAA       600
     GGPAVRPHPI TAAQLAAQLG GRLEGDDRPV TALADPTAAL PDSAVVVTSA AALEALSTQP       660
     VAAQLGALVL PDALCPAPRV ACPIIWVRDV RLALARLSAL FAPPPPRPQL SDGAVVAPDA       720
     TLGEAVSVGA GAVIGAGAVI GAGSRVGPGC VLGEGVTLGP DCVLHANVTL YPGTALGARV       780
     IVHSGAVLGA DGFGYAFGPQ GAVKIHHLGG VVIEDDVEVG ANTCIDRGTL LDTRVGARTK       840
     IDNLCQIGHN VQIGPDCVIA GGSAIGGSTV LERGVLLGGA VAVTDHVRLG AGARVGGRSS       900
     VTKSVPAGET WAGYPAKPQR KWVRELYLIG KLEAIWASVR AQGRPVSGAR TGDD             954
//

If you have problems or comments...

PBIL Back to PBIL home page