(data stored in ACNUC30630 zone)

EMBL: CP002049.PE320

CP002049.PE320       Location/Qualifiers
FT   CDS             375212..375520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0324"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="InterPro IPR006110:IPR003716; KEGG: dge:Dgeo_0252
FT                   DNA-directed RNA polymerase subunit omega; PFAM: RNA
FT                   polymerase Rpb6; SPTR: Q1J1S9 DNA-directed RNA polymerase
FT                   subunit omega; TIGRFAM: DNA-directed RNA polymerase, omega
FT                   subunit; PFAM: RNA polymerase Rpb6; TIGRFAM: DNA-directed
FT                   RNA polymerase, omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13463"
FT                   /db_xref="GOA:D7CRH3"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRH3"
FT                   /protein_id="ADI13463.1"
FT                   /translation="MAQEGFDTLMALTDSRYTLSMIVARRAAQLKLGLPSVLPKEELPV
FT                   TRNTVTIAMKELERGAALRWGRDLPSTEELRALVERERREESPAYSVSRRPAAEDDL"
     MAQEGFDTLM ALTDSRYTLS MIVARRAAQL KLGLPSVLPK EELPVTRNTV TIAMKELERG        60
     AALRWGRDLP STEELRALVE RERREESPAY SVSRRPAAED DL                          102
//

If you have problems or comments...

PBIL Back to PBIL home page