(data stored in ACNUC30630 zone)

EMBL: CP002049.PE328

CP002049.PE328       Location/Qualifiers
FT   CDS             383059..383415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0332"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_8573 formylmethionine deformylase;
FT                   SPTR: A5CQB1 Putative carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13471"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRI1"
FT                   /protein_id="ADI13471.1"
FT                   /translation="MNHPALLFRALSSAWQHDAASPHVDLLAADLAAAVGRSRHPLCVG
FT                   LVRKEAIAKLYGLVYLLDGYGVTLRQRYRDGGGAFVYAERRGEVPSEFAGAVVLEHRLA
FT                   VLSAPPAPALAEAA"
     MNHPALLFRA LSSAWQHDAA SPHVDLLAAD LAAAVGRSRH PLCVGLVRKE AIAKLYGLVY        60
     LLDGYGVTLR QRYRDGGGAF VYAERRGEVP SEFAGAVVLE HRLAVLSAPP APALAEAA         118
//

If you have problems or comments...

PBIL Back to PBIL home page