(data stored in ACNUC30630 zone)

EMBL: CP002049.PE330

CP002049.PE330       Location/Qualifiers
FT   CDS             384504..384743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ote:Oter_2486 Sel1 domain-containing protein;
FT                   SPTR: C1DYE5 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13473"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRI3"
FT                   /protein_id="ADI13473.1"
FT                   /translation="MRAPPEPSLPELHPVACPACGGDGYTLVAGSGEDEVGCAACGGFG
FT                   VVEVCSGCGAVPALEGGYEVCRCTEAALPERRAA"
     MRAPPEPSLP ELHPVACPAC GGDGYTLVAG SGEDEVGCAA CGGFGVVEVC SGCGAVPALE        60
     GGYEVCRCTE AALPERRAA                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page