(data stored in ACNUC30630 zone)

EMBL: CP002049.PE331

CP002049.PE331       Location/Qualifiers
FT   CDS             complement(384766..385620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0335"
FT                   /product="Hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="COGs: COG0181 Porphobilinogen deaminase; InterPro
FT                   IPR000860; KEGG: ttj:TTHA0345 porphobilinogen deaminase;
FT                   PFAM: Porphobilinogen deaminase; PRIAM: Hydroxymethylbilane
FT                   synthase; SPTR: C1XR62 Hydroxymethylbilane synthase; PFAM:
FT                   Porphobilinogen deaminase, C-terminal domain;
FT                   Porphobilinogen deaminase, dipyromethane cofactor binding
FT                   domain; TIGRFAM: porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13474"
FT                   /db_xref="GOA:D7CRI4"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRI4"
FT                   /protein_id="ADI13474.1"
FT                   /translation="MPRIVLGNRTGAPALAQARAVLAELSEGWPDVSISQRTLQSRGGA
FT                   DELLHALQGGRIHIAVQSLDTLPLTLPDGLSVAAVTKRLEPRSALLARGAKSLGDLPKG
FT                   AEVGVPTLRDRAFVLAARRDLKVRVFTGELEDALALLSAQELGALVWPSAPFIQLGQRE
FT                   RVTTLLEPQQLPPAPGQGALALVVRDDDDLASDLAYTLQHRPSFDRACAERAFARQMSS
FT                   SAHHIGAFASVTADGELHLLGAAARDEGDWMIQAEVTGDAAEAEELGRELAQDVLEQLK
FT                   ARA"
     MPRIVLGNRT GAPALAQARA VLAELSEGWP DVSISQRTLQ SRGGADELLH ALQGGRIHIA        60
     VQSLDTLPLT LPDGLSVAAV TKRLEPRSAL LARGAKSLGD LPKGAEVGVP TLRDRAFVLA       120
     ARRDLKVRVF TGELEDALAL LSAQELGALV WPSAPFIQLG QRERVTTLLE PQQLPPAPGQ       180
     GALALVVRDD DDLASDLAYT LQHRPSFDRA CAERAFARQM SSSAHHIGAF ASVTADGELH       240
     LLGAAARDEG DWMIQAEVTG DAAEAEELGR ELAQDVLEQL KARA                        284
//

If you have problems or comments...

PBIL Back to PBIL home page