(data stored in ACNUC30630 zone)

EMBL: CP002049.PE332

CP002049.PE332       Location/Qualifiers
FT   CDS             complement(385780..386982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0336"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COGs: COG0192 S-adenosylmethionine synthetase;
FT                   InterPro IPR002133; KEGG: ttj:TTHA1642 S-adenosylmethionine
FT                   synthetase; PFAM: S-adenosylmethionine synthetase; PRIAM:
FT                   Methionine adenosyltransferase; SPTR: Q5SHT8
FT                   S-adenosylmethionine synthetase; TIGRFAM:
FT                   S-adenosylmethionine synthetase; PFAM: S-adenosylmethionine
FT                   synthetase, C-terminal domain; S-adenosylmethionine
FT                   synthetase, central domain; S-adenosylmethionine
FT                   synthetase, N-terminal domain; TIGRFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13475"
FT                   /db_xref="GOA:D7CRI5"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRI5"
FT                   /protein_id="ADI13475.1"
FT                   /translation="MRLVTSESVTEGHPDKLADRISDSVLDAMLQIDPQARVAVETILT
FT                   KGLALIAGEVTCNGYVDLQRIVRDTVREVGYTDAAYGFDADHAAVLIALTEQSPDIAQG
FT                   VSRAQEAPSGDRFDQLGAGDQGMMFGYATDETPELMPLPITLAHALTRRLAAVRREGLL
FT                   PYLRPDGKAQVTVAYDGDRPTAVTAVVLSAQHDPDVDEATLHEDLYTHVIRAALPEAYL
FT                   RDDTAFYINPTGRFVIGGPEGDAGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRSAA
FT                   YYARYMAKNLVGAGLARRALVQLAYAIGVAHPVGIYVDTFGTAALSDDDLSRLLRTVFD
FT                   ARPAAIIAQLGLNRPMYKATSAYGHFGRPELPWERLDKVTQLRAEAAKLAPAALEAAEP
FT                   A"
     MRLVTSESVT EGHPDKLADR ISDSVLDAML QIDPQARVAV ETILTKGLAL IAGEVTCNGY        60
     VDLQRIVRDT VREVGYTDAA YGFDADHAAV LIALTEQSPD IAQGVSRAQE APSGDRFDQL       120
     GAGDQGMMFG YATDETPELM PLPITLAHAL TRRLAAVRRE GLLPYLRPDG KAQVTVAYDG       180
     DRPTAVTAVV LSAQHDPDVD EATLHEDLYT HVIRAALPEA YLRDDTAFYI NPTGRFVIGG       240
     PEGDAGLTGR KIIVDTYGGA APHGGGAFSG KDPTKVDRSA AYYARYMAKN LVGAGLARRA       300
     LVQLAYAIGV AHPVGIYVDT FGTAALSDDD LSRLLRTVFD ARPAAIIAQL GLNRPMYKAT       360
     SAYGHFGRPE LPWERLDKVT QLRAEAAKLA PAALEAAEPA                             400
//

If you have problems or comments...

PBIL Back to PBIL home page