(data stored in ACNUC30630 zone)

EMBL: CP002049.PE334

CP002049.PE334       Location/Qualifiers
FT   CDS             387818..388414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0338"
FT                   /product="protein of unknown function DUF88"
FT                   /note="COGs: COG1432 conserved hypothetical protein;
FT                   InterPro IPR002790; KEGG: ttj:TTHA1057 hypothetical
FT                   protein; PFAM: protein of unknown function DUF88; SPTR:
FT                   B7A7J0 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13477"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRI7"
FT                   /protein_id="ADI13477.1"
FT                   /translation="MTQRDPLDEDRLQPTKPAANHRFDPNAARIGEWPEQRVGLFVDTQ
FT                   NLYYAARDIYSRHVDYAVMLKLSERSRHLVHATAYVVEREGEATAYGFVTKLSALGYRV
FT                   RRRKVRVHRADSGGRPVLEGDWDMGIAADIVRAWDYLDVIVLASGDGDFAPMLELAQQR
FT                   GKRVEVLAFREAASQNLLDLADAFMGLADVPDIFV"
     MTQRDPLDED RLQPTKPAAN HRFDPNAARI GEWPEQRVGL FVDTQNLYYA ARDIYSRHVD        60
     YAVMLKLSER SRHLVHATAY VVEREGEATA YGFVTKLSAL GYRVRRRKVR VHRADSGGRP       120
     VLEGDWDMGI AADIVRAWDY LDVIVLASGD GDFAPMLELA QQRGKRVEVL AFREAASQNL       180
     LDLADAFMGL ADVPDIFV                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page