(data stored in ACNUC30630 zone)

EMBL: CP002049.PE340

CP002049.PE340       Location/Qualifiers
FT   CDS             393486..393923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0344"
FT                   /product="protein of unknown function DUF151"
FT                   /note="COGs: COG1259 conserved hypothetical protein;
FT                   InterPro IPR003729; KEGG: ttj:TTHA1615 hypothetical
FT                   protein; PFAM: protein of unknown function DUF151; SPTR:
FT                   Q72I81 Putative uncharacterized protein; PFAM:
FT                   Uncharacterised ACR, COG1259"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13483"
FT                   /db_xref="GOA:D7CRJ3"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRJ3"
FT                   /protein_id="ADI13483.1"
FT                   /translation="MDGMVRAVLEDIAVAGSGEFFVMLLKTAKGEFVPITIGHLEAMSI
FT                   LAGRSKERLPRPLSHDLMLSALELLGARIVRVEVTDLVTTDEGGTFYARLVLENRGIEL
FT                   ELDARPSDALALAVRVDAPLWVAERVVERAGLSDFTGGAEA"
     MDGMVRAVLE DIAVAGSGEF FVMLLKTAKG EFVPITIGHL EAMSILAGRS KERLPRPLSH        60
     DLMLSALELL GARIVRVEVT DLVTTDEGGT FYARLVLENR GIELELDARP SDALALAVRV       120
     DAPLWVAERV VERAGLSDFT GGAEA                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page