(data stored in ACNUC30630 zone)

EMBL: CP002049.PE350

CP002049.PE350       Location/Qualifiers
FT   CDS             complement(401219..402001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0354"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="COGs: COG0561 hydrolase of the HAD superfamily;
FT                   InterPro IPR013200:IPR006379; KEGG: ddr:Deide_3p01661
FT                   putative hydrolase; PFAM: Haloacid dehalogenase domain
FT                   protein hydrolase type 3; SPTR: C1D3N1 Putative hydrolase;
FT                   TIGRFAM: HAD-superfamily hydrolase, subfamily IIB; PFAM:
FT                   haloacid dehalogenase-like hydrolase; TIGRFAM: Cof
FT                   subfamily of IIB subfamily of haloacid dehalogenase
FT                   superfamily; HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13493"
FT                   /db_xref="GOA:D7CRK3"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRK3"
FT                   /protein_id="ADI13493.1"
FT                   /translation="MLLAFDLDNTVVTRGNEIPDPIVRAVAAARRAGHLVTVLTGRPKA
FT                   STLPFLDTLGVAGPYAVNHGAIVFGEDDAVLSRSLIAAPVVDRLVHRYGVDEGLEYAFM
FT                   FDDDIYVRDPEDPRWSWAHTLNRNVLAFHKDRVRDADKIVFSADAAGPRMLLEIRDEHP
FT                   ELMRYLWPDGFLEVTGPGAHKGAALAHICRVLGVAQRDTVAFGDGINDVTMLEWAGHAV
FT                   AVGDAHPDVLAVADERIEEPEALGVATWLEAHVQGVLS"
     MLLAFDLDNT VVTRGNEIPD PIVRAVAAAR RAGHLVTVLT GRPKASTLPF LDTLGVAGPY        60
     AVNHGAIVFG EDDAVLSRSL IAAPVVDRLV HRYGVDEGLE YAFMFDDDIY VRDPEDPRWS       120
     WAHTLNRNVL AFHKDRVRDA DKIVFSADAA GPRMLLEIRD EHPELMRYLW PDGFLEVTGP       180
     GAHKGAALAH ICRVLGVAQR DTVAFGDGIN DVTMLEWAGH AVAVGDAHPD VLAVADERIE       240
     EPEALGVATW LEAHVQGVLS                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page