(data stored in ACNUC30630 zone)

EMBL: CP002049.PE351

CP002049.PE351       Location/Qualifiers
FT   CDS             402203..402562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0355"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="InterPro IPR014314; KEGG: dge:Dgeo_0889 succinate
FT                   dehydrogenase, cytochrome b subunit; SPTR: C1XVW6 Succinate
FT                   dehydrogenase subunit C; TIGRFAM: succinate dehydrogenase,
FT                   cytochrome b556 subunit; PFAM: Succinate
FT                   dehydrogenase/Fumarate reductase transmembrane subunit;
FT                   TIGRFAM: succinate dehydrogenase, cytochrome b556 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13494"
FT                   /db_xref="GOA:D7CRK4"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="InterPro:IPR039023"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRK4"
FT                   /protein_id="ADI13494.1"
FT                   /translation="MYRGREGQWAFILHRLSGLAVFFYLMIHVVNISLASFGPQVSGPV
FT                   LSFFHQGVFRIGLVLVMAGVVYHAFNGLRIILMDFTTWGTKYHRQLWYGVLAATVAIGI
FT                   PVLWVVVPQIVADLS"
     MYRGREGQWA FILHRLSGLA VFFYLMIHVV NISLASFGPQ VSGPVLSFFH QGVFRIGLVL        60
     VMAGVVYHAF NGLRIILMDF TTWGTKYHRQ LWYGVLAATV AIGIPVLWVV VPQIVADLS        119
//

If you have problems or comments...

PBIL Back to PBIL home page