(data stored in ACNUC30630 zone)

EMBL: CP002049.PE352

CP002049.PE352       Location/Qualifiers
FT   CDS             402562..403020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0356"
FT                   /product="succinate dehydrogenase, membrane subunit (SdhD)"
FT                   /note="COGs: COG2142 Succinate dehydrogenase hydrophobic
FT                   anchor subunit; KEGG: ttj:TTHA1455 succinate dehydrogenase,
FT                   membrane subunit (SdhD); SPTR: C1XVW5 Succinate
FT                   dehydrogenase subunit D; PFAM: Succinate
FT                   dehydrogenase/Fumarate reductase transmembrane subunit;
FT                   TIGRFAM: succinate dehydrogenase, hydrophobic membrane
FT                   anchor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13495"
FT                   /db_xref="GOA:D7CRK5"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRK5"
FT                   /protein_id="ADI13495.1"
FT                   /translation="MAVRAPRTLRDARATYTTNGELAWWVFMRVSGLALIFLTFGHLYM
FT                   SNIVIDAGQIDFSYVARRLSITWVKIYDTLLLGLAVLHGVNGARYSIEDYARHPGWRFG
FT                   IKMGLYSATVLVMIIGIISLWAVDYTQYLNLPPDAMPGAAPGAVAPGH"
     MAVRAPRTLR DARATYTTNG ELAWWVFMRV SGLALIFLTF GHLYMSNIVI DAGQIDFSYV        60
     ARRLSITWVK IYDTLLLGLA VLHGVNGARY SIEDYARHPG WRFGIKMGLY SATVLVMIIG       120
     IISLWAVDYT QYLNLPPDAM PGAAPGAVAP GH                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page