(data stored in ACNUC30630 zone)

EMBL: CP002049.PE353

CP002049.PE353       Location/Qualifiers
FT   CDS             403088..404827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0357"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="COGs: COG1053 Succinate dehydrogenase/fumarate
FT                   reductase flavoprotein subunit;
FT                   InterProIPR003952:IPR013027:IPR003953:IPR004112:IPR
FT                   015939:IPR011281:IPR014006; KEGG: ttj:TTHA1454 succinate
FT                   dehydrogenase flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; SPTR: Q5SIC0 Succinate dehydrogenase, flavoprotein
FT                   subunit; TIGRFAM: succinate dehydrogenase, flavoprotein
FT                   subunit; succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunit; PFAM: domain; FAD binding domain;
FT                   TIGRFAM: succinate dehydrogenase, flavoprotein subunit, E.
FT                   coli/mitochondrial subgroup; succinate dehydrogenase or
FT                   fumarate reductase, flavoprotein
FT                   subunitGram-negative/mitochondrial subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13496"
FT                   /db_xref="GOA:D7CRK6"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRK6"
FT                   /protein_id="ADI13496.1"
FT                   /translation="MARAHKYDVIVVGAGGAGLMAARYAAQHPGVSVAVISKLYPTRSH
FT                   TGAAQGGVGAALGNVSEDHPEWHAFDTIKGGDYLTDQDVAEMFAHEVVEAVYELEHMGL
FT                   PFSRTPDGKIAQRKFGGHTREFGKSAVERACYAADRTGHMILQTLYQQSIKDNVVFFNE
FT                   FHVLDILIEGGECVGVVAYELATGQLHTFHAKATVIASGGNGRMFKVTSNAHALTGDLM
FT                   SVVYRRGIPLEDPEFYQFHPTGLYKIGVLLTEGARGEGGILRNKDGERFMERYAPTIKD
FT                   LAPRDMVSRAMYMEIREGRGAGPDNDYIHLDLTHIDAHIIETRLPDITEFARIYLGVDP
FT                   VKELVPIQPTAHYAMGGIPTTINTEVIRDGDNTIVPGLYAAGEVACASLHGANRLGTNS
FT                   LGDLIVFGRRAGIYAARYAAETSYKDLPRDEQDFSRALIDRALNGPGWERVSRIRQDLQ
FT                   ESMQDNASVFRTEETLTKQVEVLKELKERYQKIGVEDQGEQYNTELMEALELGFLLDNA
FT                   EALVHAALNRKESRGAHSREDFKERDDEAWLKHTLVYKDGEGVRIDYKPVTLGKYEPKP
FT                   RVY"
     MARAHKYDVI VVGAGGAGLM AARYAAQHPG VSVAVISKLY PTRSHTGAAQ GGVGAALGNV        60
     SEDHPEWHAF DTIKGGDYLT DQDVAEMFAH EVVEAVYELE HMGLPFSRTP DGKIAQRKFG       120
     GHTREFGKSA VERACYAADR TGHMILQTLY QQSIKDNVVF FNEFHVLDIL IEGGECVGVV       180
     AYELATGQLH TFHAKATVIA SGGNGRMFKV TSNAHALTGD LMSVVYRRGI PLEDPEFYQF       240
     HPTGLYKIGV LLTEGARGEG GILRNKDGER FMERYAPTIK DLAPRDMVSR AMYMEIREGR       300
     GAGPDNDYIH LDLTHIDAHI IETRLPDITE FARIYLGVDP VKELVPIQPT AHYAMGGIPT       360
     TINTEVIRDG DNTIVPGLYA AGEVACASLH GANRLGTNSL GDLIVFGRRA GIYAARYAAE       420
     TSYKDLPRDE QDFSRALIDR ALNGPGWERV SRIRQDLQES MQDNASVFRT EETLTKQVEV       480
     LKELKERYQK IGVEDQGEQY NTELMEALEL GFLLDNAEAL VHAALNRKES RGAHSREDFK       540
     ERDDEAWLKH TLVYKDGEGV RIDYKPVTLG KYEPKPRVY                              579
//

If you have problems or comments...

PBIL Back to PBIL home page