(data stored in ACNUC30630 zone)

EMBL: CP002049.PE354

CP002049.PE354       Location/Qualifiers
FT   CDS             404916..405641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0358"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /note="COGs: COG0479 Succinate dehydrogenase/fumarate
FT                   reductase Fe-S protein subunit;
FT                   InterProIPR017900:IPR017896:IPR009051:IPR001041:IPR
FT                   012675:IPR012285:IPR004489; KEGG: tth:TTC1089 succinate
FT                   dehydrogenase iron-sulfur subunit; PRIAM: Succinate
FT                   dehydrogenase; SPTR: Q72IP3 Succinate dehydrogenase
FT                   iron-sulfur protein; TIGRFAM: succinate dehydrogenase and
FT                   fumarate reductase iron-sulfur protein; TIGRFAM: succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13497"
FT                   /db_xref="GOA:D7CRK7"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRK7"
FT                   /protein_id="ADI13497.1"
FT                   /translation="MATAPANLERQIRVRIKRFNPEQDKRPYWAEYNVTARTTDRVLDV
FT                   LHQIKWEMDGTLSFRRSCAHGICGSDAMLINGVNRLACKVLVKDLGDTISVEPIRGLRV
FT                   IKDMIVDMEPFFDSYKAVLPYFINDTPAPSGERYQSPEDREIFDATTKCILCAACTTSC
FT                   PVFWANGSYIGPAAIVNAHRFIFDSRDEGTADRLEVLGKANGLWRCRTAYNCTEACPRG
FT                   IPVTQAIEDVKRELLWRRT"
     MATAPANLER QIRVRIKRFN PEQDKRPYWA EYNVTARTTD RVLDVLHQIK WEMDGTLSFR        60
     RSCAHGICGS DAMLINGVNR LACKVLVKDL GDTISVEPIR GLRVIKDMIV DMEPFFDSYK       120
     AVLPYFINDT PAPSGERYQS PEDREIFDAT TKCILCAACT TSCPVFWANG SYIGPAAIVN       180
     AHRFIFDSRD EGTADRLEVL GKANGLWRCR TAYNCTEACP RGIPVTQAIE DVKRELLWRR       240
     T                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page