(data stored in ACNUC30630 zone)

EMBL: CP002049.PE362

CP002049.PE362       Location/Qualifiers
FT   CDS             413165..414637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0366"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /note="COGs: COG0154 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase A subunit and related amidase; InterPro
FT                   IPR020556:IPR000120:IPR004412; KEGG: dra:DR_1856
FT                   aspartyl/glutamyl-tRNA amidotransferase subunit A; PFAM:
FT                   Amidase; SPTR: Q9RTA9 Glutamyl-tRNA(Gln) amidotransferase
FT                   subunit A; TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase; TIGRFAM: glutamyl-tRNA(Gln) and/or
FT                   aspartyl-tRNA(Asn) amidotransferase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13505"
FT                   /db_xref="GOA:D7CRL5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRL5"
FT                   /protein_id="ADI13505.1"
FT                   /translation="MARYAARVTLACDIAEAVGSGRERAETVVRRALSRADRVQRETNA
FT                   FITLCGEAALARARALDARLAAGEAPPPLAGVPVAVKDNLCTRGVRTTAGSRSLEHFVP
FT                   PFDATVVARLEAAGAVVIGKTNLDEFGMGSTNEHSAFGPVRNPWDLERVPGGSSGGSAV
FT                   AVAAGVVPLALGTDTGGSVRQPASFTGVLGFKPTYGVLSRSGVIAFASSLDQVGVFGRS
FT                   ARDLALALTAMAGPDPLDATSLEAPPLSADLGTGTELSGLRVGLIKELSGAGNSPEVRE
FT                   ALGRTTAALRDLGAEVSEVSLPHAPYGTAAYYIVAPAEASSNLARFDGMVYSRRVGESR
FT                   LGQGEVMRRSRGALFGPEVRRRILVGTYALSAGYYEAFYGKALKVRRLIADEVRRAFGR
FT                   FDLLLTPTAPSPAYRLGEVADPLRMYLGDVDTVLANLVGCGAVSVPAPTPGLPCGVQFL
FT                   APPLEDARLLRVAGALEAAAAGAFAPLAPAYR"
     MARYAARVTL ACDIAEAVGS GRERAETVVR RALSRADRVQ RETNAFITLC GEAALARARA        60
     LDARLAAGEA PPPLAGVPVA VKDNLCTRGV RTTAGSRSLE HFVPPFDATV VARLEAAGAV       120
     VIGKTNLDEF GMGSTNEHSA FGPVRNPWDL ERVPGGSSGG SAVAVAAGVV PLALGTDTGG       180
     SVRQPASFTG VLGFKPTYGV LSRSGVIAFA SSLDQVGVFG RSARDLALAL TAMAGPDPLD       240
     ATSLEAPPLS ADLGTGTELS GLRVGLIKEL SGAGNSPEVR EALGRTTAAL RDLGAEVSEV       300
     SLPHAPYGTA AYYIVAPAEA SSNLARFDGM VYSRRVGESR LGQGEVMRRS RGALFGPEVR       360
     RRILVGTYAL SAGYYEAFYG KALKVRRLIA DEVRRAFGRF DLLLTPTAPS PAYRLGEVAD       420
     PLRMYLGDVD TVLANLVGCG AVSVPAPTPG LPCGVQFLAP PLEDARLLRV AGALEAAAAG       480
     AFAPLAPAYR                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page