(data stored in ACNUC30630 zone)

EMBL: CP002049.PE364

CP002049.PE364       Location/Qualifiers
FT   CDS             414955..415347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0368"
FT                   /product="ribonuclease P protein component"
FT                   /note="InterPro IPR020539:IPR000100:IPR020568:IPR014721;
FT                   KEGG: tth:TTC0077 ribonuclease P protein subunit; PFAM:
FT                   ribonuclease P protein; SPTR: C1XNH4 Ribonuclease P protein
FT                   component; TIGRFAM: ribonuclease P protein component; PFAM:
FT                   Ribonuclease P; TIGRFAM: ribonuclease P protein component,
FT                   eubacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13507"
FT                   /db_xref="GOA:D7CRL7"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRL7"
FT                   /protein_id="ADI13507.1"
FT                   /translation="MPVIQSLKGDRAFQRLRRGRAGHAKLLSLRWRPLRPPSGAPAGAP
FT                   VSTAFVGIVVSKKVGKAVLRNRVRRRLREALRAVLACAEARANPAQGLRHPAFELVIIA
FT                   RPDAAEADYGQLRSALEHALRKGQLL"
     MPVIQSLKGD RAFQRLRRGR AGHAKLLSLR WRPLRPPSGA PAGAPVSTAF VGIVVSKKVG        60
     KAVLRNRVRR RLREALRAVL ACAEARANPA QGLRHPAFEL VIIARPDAAE ADYGQLRSAL       120
     EHALRKGQLL                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page