(data stored in ACNUC30630 zone)

EMBL: CP002049.PE372

CP002049.PE372       Location/Qualifiers
FT   CDS             complement(421905..423953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0376"
FT                   /product="cobyric acid synthase CobQ"
FT                   /EC_number="2.7.7.62"
FT                   /note="COGs: COG1492 Cobyric acid synthase;
FT                   InterProIPR002586:IPR011698:IPR003203:IPR017929:IPR 004459;
FT                   KEGG: dge:Dgeo_2874 cobyric acid synthase CobQ; PFAM:
FT                   CobB/CobQ domain protein glutamine amidotransferase;
FT                   Cobyrinic acid ac-diamide synthase; cobalbumin biosynthesis
FT                   protein; PRIAM: Adenosylcobinamide-phosphate
FT                   guanylyltransferase; SPTR: Q1J2I1 Cobyric acid synthase
FT                   CobQ; TIGRFAM: cobyric acid synthase CobQ; PFAM: Cobinamide
FT                   kinase / cobinamide phosphate guanyltransferase;
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain;
FT                   CobB/CobQ-like glutamine amidotransferase domain; TIGRFAM:
FT                   cobyric acid synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13515"
FT                   /db_xref="GOA:D7CRM5"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRM5"
FT                   /protein_id="ADI13515.1"
FT                   /translation="MVQGCSSGAGKSYLTAALCRLYARRGVRVAPFKAQNMSNNAGVTP
FT                   DGLEMSRAQLVQARAARVVPDVRMNPVLLKPEGDRRSQVVLLGRADPALSRLPWEARKA
FT                   RLWPHVAASLRGLLEAFELVILEGAGSPAEVNLKAGDIVNMRAALEADAKVLLVADIDR
FT                   GGAFAHLLGTWACLEAAERETLLGFVLNKFRGDPALLGDATAWLAARTGRPTLGVVPYL
FT                   PLALPEEDAQDLPPAGAAAREAPVRVAALRFPTVSNFDEFGPLARHPAVALSWVEAPSA
FT                   LAAADLIVLPGSKHLTTDAAWLQRTGLGAAVQERAESGALVLGICGGMQLLGRVIHDPH
FT                   GLEGAAGTVTGLGLLDLETTLAPIKVTRNVQSTLLATGETVTGYEIHHGRTRAGGRAQP
FT                   LLADGLGFRQGRVLGVYPHGLLEDAAFVRYLLGALGVSAAQLDPEAGLEAALDRLADHV
FT                   EAHLDVSAIDDALFRGRAPRRPPRLVLVTGGARSGKSRYAEALVRRFLEPGEGALYLAT
FT                   LRASDPEMARRVARHRARRPVSWRTLETPLAPAEALAAAPERVVLLDCLSGYVANLLLS
FT                   RYAAGEQSEAEAAAQAGDEAIAAALAGVDALLGAVRRAGKTVVVVTNEVGSGVVPAYAL
FT                   GRLFRDALGLANARVAAAADAVALCVVGLPQLLKGTLPEVTLDEGDA"
     MVQGCSSGAG KSYLTAALCR LYARRGVRVA PFKAQNMSNN AGVTPDGLEM SRAQLVQARA        60
     ARVVPDVRMN PVLLKPEGDR RSQVVLLGRA DPALSRLPWE ARKARLWPHV AASLRGLLEA       120
     FELVILEGAG SPAEVNLKAG DIVNMRAALE ADAKVLLVAD IDRGGAFAHL LGTWACLEAA       180
     ERETLLGFVL NKFRGDPALL GDATAWLAAR TGRPTLGVVP YLPLALPEED AQDLPPAGAA       240
     AREAPVRVAA LRFPTVSNFD EFGPLARHPA VALSWVEAPS ALAAADLIVL PGSKHLTTDA       300
     AWLQRTGLGA AVQERAESGA LVLGICGGMQ LLGRVIHDPH GLEGAAGTVT GLGLLDLETT       360
     LAPIKVTRNV QSTLLATGET VTGYEIHHGR TRAGGRAQPL LADGLGFRQG RVLGVYPHGL       420
     LEDAAFVRYL LGALGVSAAQ LDPEAGLEAA LDRLADHVEA HLDVSAIDDA LFRGRAPRRP       480
     PRLVLVTGGA RSGKSRYAEA LVRRFLEPGE GALYLATLRA SDPEMARRVA RHRARRPVSW       540
     RTLETPLAPA EALAAAPERV VLLDCLSGYV ANLLLSRYAA GEQSEAEAAA QAGDEAIAAA       600
     LAGVDALLGA VRRAGKTVVV VTNEVGSGVV PAYALGRLFR DALGLANARV AAAADAVALC       660
     VVGLPQLLKG TLPEVTLDEG DA                                                682
//

If you have problems or comments...

PBIL Back to PBIL home page