(data stored in ACNUC30630 zone)

EMBL: CP002049.PE375

CP002049.PE375       Location/Qualifiers
FT   CDS             complement(425683..426630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0379"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="COGs: COG1270 Cobalamin biosynthesis protein
FT                   CobD/CbiB; InterPro IPR004485; KEGG: gau:GAU_0492 cobalamin
FT                   biosynthesis protein CobD; PFAM: cobalamin biosynthesis
FT                   protein CbiB; SPTR: C1A5M4 Cobalamin biosynthesis protein
FT                   CobD; TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   CobD/Cbib protein; TIGRFAM: cobalamin biosynthesis protein
FT                   CobD"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13518"
FT                   /db_xref="GOA:D7CRM8"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRM8"
FT                   /protein_id="ADI13518.1"
FT                   /translation="MAPVGVPFGAALLSLALDLCFGEPPARLHPVVAMGRYLNLKGALL
FT                   ARARRPRARLAAGFGFVALGAALSGGLAWGVQRGAQRLPDPARRPLLACALAPLFSVRA
FT                   LLTAGGAVRDALAAGDLTAARRLLGWHLVSRETAGLTPSEVAGAAVASLAENLTDSITA
FT                   PLLYAAAFGLPGAAVYRFVNTADAVLGYRTPALEHFGRAAARADDLLSFVPARLSGGLL
FT                   LLALTLAGGDARAAWRGLKRDARRTPSPNGGVTMALAAAGLGVRLEKRGVYVLNAAGRA
FT                   PTAADIGRAQQLVGAALGLGMLGWWLLGSARARA"
     MAPVGVPFGA ALLSLALDLC FGEPPARLHP VVAMGRYLNL KGALLARARR PRARLAAGFG        60
     FVALGAALSG GLAWGVQRGA QRLPDPARRP LLACALAPLF SVRALLTAGG AVRDALAAGD       120
     LTAARRLLGW HLVSRETAGL TPSEVAGAAV ASLAENLTDS ITAPLLYAAA FGLPGAAVYR       180
     FVNTADAVLG YRTPALEHFG RAAARADDLL SFVPARLSGG LLLLALTLAG GDARAAWRGL       240
     KRDARRTPSP NGGVTMALAA AGLGVRLEKR GVYVLNAAGR APTAADIGRA QQLVGAALGL       300
     GMLGWWLLGS ARARA                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page