(data stored in ACNUC30630 zone)

EMBL: CP002049.PE386

CP002049.PE386       Location/Qualifiers
FT   CDS             439293..440735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0390"
FT                   /product="type III restriction protein res subunit"
FT                   /note="COGs: COG1061 DNA or RNA helicase of superfamily II;
FT                   InterPro IPR006935:IPR001650:IPR014021:IPR014001; KEGG:
FT                   amr:AM1_2461 type III restriction enzyme, res subunit;
FT                   PFAM: type III restriction protein res subunit; helicase
FT                   domain protein; SMART: DEAD-like helicase ; helicase domain
FT                   protein; SPTR: B0C478 Type III restriction enzyme, res
FT                   subunit; PFAM: Helicase conserved C-terminal domain; Type
FT                   III restriction enzyme, res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13529"
FT                   /db_xref="GOA:D7CRN9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040699"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRN9"
FT                   /protein_id="ADI13529.1"
FT                   /translation="MPQPSRLTFDRGTLILHLPPAGHSWVQFATWDDRIERFRLPALAY
FT                   RPFLEAMRAEGVAVVDKARAFGALQLTPATEVTPFAHQLEALRAWKRSGRRGVVVLPTG
FT                   SGKTYLAQLAMQATPRSTLVVVPTLDLMHQWYAHLRAAFPDVEVGLLGGGSKDRTPLLI
FT                   ATYDSAAMHAETLGNRYGLLVFDECHHLPGAFYRAVAEYALAPYRLGLSATLERSDGKH
FT                   ADLERLIGPVVLRRTPAELAGGALAEHRVVQIRVKLSAAERARYDALIGTRNAFLAQQG
FT                   ISLGTLSGWGRFVRASARSKAGRAAMLAHREARAIAFGTEGKLRVLADLLRRHFPERTL
FT                   VFTDDNATVYRVSQDFLIPAITHQTKVKERHEILARFRSGAYPVLVTSRVLNEGVDVPA
FT                   AKVAVVLSGTGSTREYVQRLGRILRRGEGKLAVLYEVVAEGTSEEGVSRRRRGERPEAP
FT                   PRFERIGDEETVTLDDLGAPGP"
     MPQPSRLTFD RGTLILHLPP AGHSWVQFAT WDDRIERFRL PALAYRPFLE AMRAEGVAVV        60
     DKARAFGALQ LTPATEVTPF AHQLEALRAW KRSGRRGVVV LPTGSGKTYL AQLAMQATPR       120
     STLVVVPTLD LMHQWYAHLR AAFPDVEVGL LGGGSKDRTP LLIATYDSAA MHAETLGNRY       180
     GLLVFDECHH LPGAFYRAVA EYALAPYRLG LSATLERSDG KHADLERLIG PVVLRRTPAE       240
     LAGGALAEHR VVQIRVKLSA AERARYDALI GTRNAFLAQQ GISLGTLSGW GRFVRASARS       300
     KAGRAAMLAH REARAIAFGT EGKLRVLADL LRRHFPERTL VFTDDNATVY RVSQDFLIPA       360
     ITHQTKVKER HEILARFRSG AYPVLVTSRV LNEGVDVPAA KVAVVLSGTG STREYVQRLG       420
     RILRRGEGKL AVLYEVVAEG TSEEGVSRRR RGERPEAPPR FERIGDEETV TLDDLGAPGP       480
//

If you have problems or comments...

PBIL Back to PBIL home page