(data stored in ACNUC30630 zone)

EMBL: CP002049.PE393

CP002049.PE393       Location/Qualifiers
FT   CDS             447542..448144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0398"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: COL4A4; collagen, type IV, alpha 4; K06237
FT                   collagen, type IV, alpha; SPTR: C1E8K9 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13536"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRP6"
FT                   /protein_id="ADI13536.1"
FT                   /translation="MQAPRRPWRQPPLLPLLFLTACAGVAGEVSDRLSVLATQSCVGTA
FT                   RATERVAPGVTLHYDNAFFCSDAPVRERYTFTVRVTNPASSTVSATLQGLELRLSTPRP
FT                   RGRGPEVTGAASGLPLTLAPGESGSFVVSGLYELVRTDEGGKANAHFHVRGGAGNPFHL
FT                   GLNAHFRGASGREAAPPAGRPGGPPRRPGPPPRPGPG"
     MQAPRRPWRQ PPLLPLLFLT ACAGVAGEVS DRLSVLATQS CVGTARATER VAPGVTLHYD        60
     NAFFCSDAPV RERYTFTVRV TNPASSTVSA TLQGLELRLS TPRPRGRGPE VTGAASGLPL       120
     TLAPGESGSF VVSGLYELVR TDEGGKANAH FHVRGGAGNP FHLGLNAHFR GASGREAAPP       180
     AGRPGGPPRR PGPPPRPGPG                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page