(data stored in ACNUC30630 zone)

EMBL: CP002049.PE395

CP002049.PE395       Location/Qualifiers
FT   CDS             complement(448881..449510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0400"
FT                   /product="CBS domain containing protein"
FT                   /note="COGs: COG0517 FOG: CBS domain; InterPro
FT                   IPR000644:IPR013785; KEGG: ttj:TTHA0829 putative acetoin
FT                   utilization protein, acetoin dehydrogenase; PFAM: CBS
FT                   domain containing protein; SMART: CBS domain containing
FT                   protein; SPTR: C1XQK5 CBS domain-containing protein; PFAM:
FT                   CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13538"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRP8"
FT                   /protein_id="ADI13538.1"
FT                   /translation="MFVSEWMTATPQTVSSKTPVMEAMQLLRKGGYRRLPVVDGDKLVG
FT                   IVTDRDLKEATPSKATTLSVYELNYLLSKLTVHDVMVTPVITVAPEEPVENAALLMEEH
FT                   KISGLPVVSGGTLQGIFTITDMLRAIVAMLGLKEGGTRVTVSLPDEPGVLARAASAAAP
FT                   SNIIAVVTAGVQAGHKRELVLRVTGEGAESFPERLRAGGLEVTDVR"
     MFVSEWMTAT PQTVSSKTPV MEAMQLLRKG GYRRLPVVDG DKLVGIVTDR DLKEATPSKA        60
     TTLSVYELNY LLSKLTVHDV MVTPVITVAP EEPVENAALL MEEHKISGLP VVSGGTLQGI       120
     FTITDMLRAI VAMLGLKEGG TRVTVSLPDE PGVLARAASA AAPSNIIAVV TAGVQAGHKR       180
     ELVLRVTGEG AESFPERLRA GGLEVTDVR                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page