(data stored in ACNUC30630 zone)

EMBL: CP002049.PE396

CP002049.PE396       Location/Qualifiers
FT   CDS             449625..450941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0401"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="COGs: COG0743 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; InterPro
FT                   IPR013512:IPR013644:IPR003821:IPR016040; KEGG: tth:TTC0504
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase; PFAM:
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase domain
FT                   protein; PRIAM: 1-deoxy-D-xylulose-5-phosphate
FT                   reductoisomerase; SPTR: C1XT38 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase; TIGRFAM: 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase; PFAM: 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase; 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase C-terminal; TIGRFAM:
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13539"
FT                   /db_xref="GOA:D7CRP9"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRP9"
FT                   /protein_id="ADI13539.1"
FT                   /translation="MQADYTETPPAGAACTGAYRVGAYGVGACWAARAWLRAGGRLAPA
FT                   RRKGHNGRMTPPYDAPTPDAPPKRLSVLGSTGSIGTQALQVARWRGYEVVALAAGRNAA
FT                   RLIEQVRTFRPQLVSCDAAVADEVRAALPAGTQLAVGEPAAVAAHPADVVVAAIPGYAG
FT                   LEPTLAALREGRHVALANKEAMVVAGPLVWETARAHGARLTPVDSELSALFQCLQGEPR
FT                   EAVAALVLTASGGPFRLAPEDLSGVSPAAALKHPTWNMGHKVTIDSATLFNKGLEVLES
FT                   HFFFDWPLERIEVVIHPQSLVHSLVRFKDGNLKAQIGSHDMRLPIQVALEAPDRPPTPL
FT                   APLPLVGVWEFYEPDTARFPSLALAYEAGRRGGTAPAALNAADEVAVEAFLAGRIGFMD
FT                   IPRALEHALTQVPHAALSWEAIPEADREARRAVRALFRL"
     MQADYTETPP AGAACTGAYR VGAYGVGACW AARAWLRAGG RLAPARRKGH NGRMTPPYDA        60
     PTPDAPPKRL SVLGSTGSIG TQALQVARWR GYEVVALAAG RNAARLIEQV RTFRPQLVSC       120
     DAAVADEVRA ALPAGTQLAV GEPAAVAAHP ADVVVAAIPG YAGLEPTLAA LREGRHVALA       180
     NKEAMVVAGP LVWETARAHG ARLTPVDSEL SALFQCLQGE PREAVAALVL TASGGPFRLA       240
     PEDLSGVSPA AALKHPTWNM GHKVTIDSAT LFNKGLEVLE SHFFFDWPLE RIEVVIHPQS       300
     LVHSLVRFKD GNLKAQIGSH DMRLPIQVAL EAPDRPPTPL APLPLVGVWE FYEPDTARFP       360
     SLALAYEAGR RGGTAPAALN AADEVAVEAF LAGRIGFMDI PRALEHALTQ VPHAALSWEA       420
     IPEADREARR AVRALFRL                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page