(data stored in ACNUC30630 zone)

EMBL: CP002049.PE397

CP002049.PE397       Location/Qualifiers
FT   CDS             451026..452183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0402"
FT                   /product="peptidase M50"
FT                   /note="COGs: COG1994 Zn-dependent protease; InterPro
FT                   IPR008915:IPR000644:IPR016483:IPR013785; KEGG:
FT                   hla:Hlac_2601 peptidase M50; PFAM: peptidase M50; CBS
FT                   domain containing protein; SMART: CBS domain containing
FT                   protein; SPTR: C1XPA8 Zn-dependent protease; PFAM: CBS
FT                   domain; Peptidase family M50"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13540"
FT                   /db_xref="GOA:D7CRQ0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:D7CRQ0"
FT                   /protein_id="ADI13540.1"
FT                   /translation="MFRNAYTLPFRLLGIPVRLDLSFLLILLLFTWMIGLQVGVFTRLF
FT                   NALLGLTIDLRPLVRGGTPFLLGFLSTLGLFVGVALHELGHAVVARRFGVQVKDITLMF
FT                   LGGVVQFDEMPRQRGAEALVAIAGPITSLLIAGVCWFVLQAVPTGFDATLFVLAFLTFQ
FT                   NVVLALFNLLPALPLDGGRVLRSLLALRLPYLQATEISAAISRIIALLLGFYGVLNLNL
FT                   LLVILAFFIYTAVRGETQYAQTSELLAGLQVRDLMTREVISVEPDWPVSQLMQLMLIRK
FT                   HLGYPVLEDGRLVGFVKLQHVRDLDEGTTVRDIMAREVSTIAPEASAVEAFRRISERDL
FT                   GRLVVVDARGEMVGILSKTDLIRTLQVRLVGSEVRPSPSSSPGGA"
     MFRNAYTLPF RLLGIPVRLD LSFLLILLLF TWMIGLQVGV FTRLFNALLG LTIDLRPLVR        60
     GGTPFLLGFL STLGLFVGVA LHELGHAVVA RRFGVQVKDI TLMFLGGVVQ FDEMPRQRGA       120
     EALVAIAGPI TSLLIAGVCW FVLQAVPTGF DATLFVLAFL TFQNVVLALF NLLPALPLDG       180
     GRVLRSLLAL RLPYLQATEI SAAISRIIAL LLGFYGVLNL NLLLVILAFF IYTAVRGETQ       240
     YAQTSELLAG LQVRDLMTRE VISVEPDWPV SQLMQLMLIR KHLGYPVLED GRLVGFVKLQ       300
     HVRDLDEGTT VRDIMAREVS TIAPEASAVE AFRRISERDL GRLVVVDARG EMVGILSKTD       360
     LIRTLQVRLV GSEVRPSPSS SPGGA                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page